KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0353Help
Entry
NMB0353           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K03270  3-deoxy-D-manno-octulosonate 8-phosphate phosphatase (KDO 8-P phosphatase) [EC:3.1.3.45]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00540  Lipopolysaccharide biosynthesis
nme01100  Metabolic pathways
Module
nme_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    NMB0353
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:nme01005]
    NMB0353
Enzymes [BR:nme01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.45  3-deoxy-manno-octulosonate-8-phosphatase
     NMB0353
Lipopolysaccharide biosynthesis proteins [BR:nme01005]
 Unusual sugar
  NMB0353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase Hydrolase_3 HAD_2 HAD
Motif
Other DBs
NCBI-GeneID: 902468
NCBI-ProteinID: NP_273402
UniProt: Q9K137
Position
361263..361799
Genome map
AA seq 178 aa AA seqDB search
MQAISPELQARAAKIKLLILDVDGVLTDGRIFIRDNGEEIKSFHTLDGHGLKMLQASGVQ
TAIITGRDAPSVGIRVKQLGINYYFKGISDKRAAYEELRAQAGVEEAECAFVGDDVVDLP
VMVRCGLPVAVPGAHWFTRQHAAYITEHAGGAGAVREVCDLIMQAQGTLGAALNEYIK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcaatttctcccgaattacaggcgcgcgccgccaaaatcaaactgttgatcctg
gatgtggacggcgttttgaccgacgggcgcatctttatccgcgataacggcgaagaaatc
aaatcgtttcacacactggacggacacggtctgaaaatgcttcaggcaagcggcgtgcag
actgcgattatcacgggccgggacgcgccctccgtcggcatccgcgtcaaacagttgggc
ataaattactatttcaaaggtatcagcgacaaacgtgccgcctatgaagaattgcgcgcg
caggcgggcgtggaagaagccgagtgcgcctttgtcggcgacgacgtggtcgatttgccg
gtaatggtgcgctgcggattgccggttgccgtccccggcgcgcattggtttacgcggcaa
cacgccgcctatatcacggaacacgcgggcggcgcaggcgcggtgcgcgaagtgtgcgac
ctgattatgcaggcgcaagggactttgggcgcggctttgaacgagtacatcaaatga

DBGET integrated database retrieval system