KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0358Help
Entry
NMB0358           CDS       T00027                                 

Gene name
aroE
Definition
(RefSeq) shikimate dehydrogenase
  KO
K00014  shikimate dehydrogenase [EC:1.1.1.25]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0358 (aroE)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.25  shikimate dehydrogenase
     NMB0358 (aroE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Shikimate_dh_N Shikimate_DH SDH_C Sacchrp_dh_NADP F420_oxidored
Motif
Other DBs
NCBI-GeneID: 902474
NCBI-ProteinID: NP_273407
UniProt: P56992
Position
complement(364869..365678)
Genome map
AA seq 269 aa AA seqDB search
MTALPRYAVFGNPVAHSKSPQIHQQFALQEGVDIEYERICADIGGFAQAVSTFFETGGCG
ANVTVPFKQEAFHLADEHSERALAAGAVNTLIPLKNGKLRGDNTDGIGLTNDITQVKNIA
IEGKTILLLGAGGAVRGVIPVLKEHRPARIVIANRTRAKAEELAQLFGIEAVPMADVNGG
FDIIINGTSGGLNGQIPDIPPDIFQNCALAYDMVYGCAAKPFLDFARQSGAKKTADGLGM
LVGQAAASYALWRGFTPDIRPVIEYMKAL
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccctcccccgctacgccgttttcggcaaccccgtcgcccacagcaaatcgccg
caaattcatcaacaatttgcccttcaggaaggcgttgacattgaatacgaacgcatttgc
gccgacatcggcggtttcgcgcaggcggtttcgacattttttgaaacaggcggttgcggg
gcaaacgttaccgtaccgttcaaacaggaagcgtttcatctggcggacgagcattccgaa
cgcgcattggcggcaggtgcggtcaatacgctgattccgttgaaaaacggcaagctgcgt
ggcgacaacaccgacggtatcggtttgaccaacgacatcacgcaggtcaaaaatattgcc
atcgagggcaaaaccattttgcttttgggcgcaggcggcgcggtgcgcggcgtgattcct
gttttgaaagaacaccgtcctgcccgtatcgtcattgccaaccgtacccgcgccaaagcc
gaggaattggcgcagcttttcggcattgaagccgtcccgatggcggacgtgaacggcggt
tttgatatcatcatcaacggcacgtcgggcggtctaaacggtcagattcccgatattccg
cccgatatttttcaaaactgcgcgcttgcctacgatatggtgtacggctgcgcggcaaaa
ccgtttttagattttgcacgacaatcgggtgcgaaaaaaactgccgacggactgggtatg
ctagtcggtcaagcggcggcttcctacgccctctggcgcggatttacgcccgatatccgc
cccgttatcgaatacatgaaagccctataa

DBGET integrated database retrieval system