KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0360Help
Entry
NMB0360           CDS       T00027                                 

Definition
(RefSeq) AmpG-like protein
  KO
K08218  MFS transporter, PAT family, beta-lactamase induction signal transducer AmpG
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09160 Human Diseases
  09168 Drug resistance
   01501 beta-Lactam resistance
    NMB0360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0360
Transporters [BR:nme02000]
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Peptide-acetyl-CoA transporter (PAT) [TC:2.A.1.25]
    NMB0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Acatn
Motif
Other DBs
NCBI-GeneID: 902476
NCBI-ProteinID: NP_273409
UniProt: Q9K133
Position
367552..368835
Genome map
AA seq 427 aa AA seqDB search
MTASKSGFIGQIFSRNMLVCIFTGFTSGLPLYFLINLIPAWLRSEQVDLKSIGLMALIGL
PFTWKFLWSPLMDAVRLPVLGRRRGWMLLTQAGLLAALAVYAFLNPRNHLPLIAGLSVLV
AFFSASQDIVLDAFRREILSDEELGLGNSVHVNAYRIAALIPGSLSLVLADRMPWLEVFV
ITSLFMLPGLLMTLFLAREPVLPPAVPKTLKQTVVEPFKEFFTRKGIASAVCVLLFIFLY
KLGDSMATALATPFYLDMGFSKTDIGLIAKNAGLWPAVAAGILGGVWMLKIGVNKALWLF
GAVQAVTVLGFVWLAGFGPFDTVGTGERLMLAAVIGAEAVGVGLGTAAFVSYMARETNPA
FTATQLALFTSLSAVPRTVINSFAGYLIEWLGYVPFFQLCFALALPGMLLLLKVAPWNGE
KTQDAGR
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgactgcatcgaaatcaggttttatcgggcaaatcttttcccgcaatatgcttgtctgt
atttttacggggtttacctcggggctgccgctgtactttctgattaacctgattccggcg
tggttgcgcagcgagcaggtggatttgaagagcatcgggctgatggcgttaatcggtctg
ccgtttacttggaaatttttgtggtcgccgctgatggacgcggtcaggctgcccgttttg
ggacggcggcgcgggtggatgctgctgacgcaggcagggttgctggcggctttggcggtc
tatgcctttttaaacccccgtaatcatctgccgctgattgccggcttgtcggtgcttgtc
gcttttttttccgccagtcaggatattgtattggatgcgttcaggcgcgagattttgtca
gacgaagaattgggtttgggcaactcggttcatgtgaacgcctaccggattgccgccctg
attcccggttcattgagtttggtgttggcagacaggatgccgtggttagaagtatttgtt
atcacttcattatttatgctgcccggccttctgatgacgctgtttcttgcgcgcgaaccc
gtgttgcctcctgccgttcctaaaacgttgaagcagaccgtggtagagccgtttaaagaa
ttttttacgcgcaagggcatcgcttcggcggtgtgcgtgctgctgtttatcttcctttac
aaactcggcgacagtatggcaaccgcgttggcaacgccgttttatctggatatgggtttc
agcaagaccgacatcggtttgattgcgaaaaatgcaggactgtggccggcagtggcggca
ggtatcttgggcggtgtgtggatgctgaaaatcggcgtaaacaaagccttgtggctattc
ggcgcggtgcaggctgtaaccgttttggggtttgtatggctggcagggttcggacctttc
gacacggtcggcacaggcgagaggctgatgctggcggcagttatcggcgcggaagcggtc
ggcgtggggttggggacggcggcgttcgtatcgtatatggcgcgtgaaaccaatcccgca
tttaccgcaacgcagcttgcgctgtttaccagcctgtccgccgtcccgcgcacggtcatc
aattcctttgccggttatctgattgaatggctcggttatgtaccgtttttccaactgtgt
ttcgcactcgccctaccgggtatgctgctgctgctgaaagttgcgccttggaacggggag
aaaactcaggatgcaggcagatga

DBGET integrated database retrieval system