KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0388Help
Entry
NMB0388           CDS       T00027                                 

Definition
(RefSeq) sugar transporter
  KO
K16211  maltose/moltooligosaccharide transporter
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0388
Transporters [BR:nme02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   NMB0388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF2599
Motif
Other DBs
NCBI-GeneID: 902503
NCBI-ProteinID: NP_273437
UniProt: Q9K111
Position
390665..392020
Genome map
AA seq 451 aa AA seqDB search
MSEYTPQTAKQGLPALAKSTIWMLSFGFLGVQTAFTLQSSQMSRIFQTLGADPHNLGWFF
ILPPLAGMLVQPIVGHYSDRTWKPRLGGRRLPYLLYGTLIAVIVMILMPNSGSFGFGYAS
LAALSFGALMIALLDVSSNMAMQPFKMMVGDMVNEEQKGYAYGIQSFLANTGAVVAAILP
FVFAYIGLANTAEKGVVPQTVVVAFYVGAALLVITSAFTIFKVKEYDPETYARYHGIDVA
ANQEKANWIELLKTAPKAFWTVTLVQFFCWFAFQYMWTYSAGAIAENVWHTTDASSVGYQ
EAGNWYGVLAAVQSVAAVICSFVLAKVPNKYHKAGYFGCLALGALGFFSVFFIGNQYALV
LSYTLIGIAWAGIITYPLTIVTNALSGKHMGTYLGLFNGSICMPQIVASLLSFVLFPMLG
GLQATMFLVGGVVLLLGAFSVFLIKETHGGV
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaatatacgcctcaaacagcaaaacaaggtttgcccgcgctggcaaaaagcacg
atttggatgctcagtttcggctttctcggcgttcagacggcctttaccctgcaaagctcg
caaatgagccgcatttttcaaacgctaggcgcagacccgcacaatttgggctggtttttc
atcctgccgccgctggcggggatgctggtgcagccgattgtcggccattactccgaccgc
acttggaagccgcgtttgggcggccgccgtctgccgtatctgctttatggcacgctgatt
gcggttattgtgatgattttgatgccgaactcgggcagcttcggtttcggctatgcgtcg
ctggcggctttgtcgttcggcgcgctgatgattgcgctgttagacgtgtcgtcaaatatg
gcgatgcagccgtttaagatgatggtcggcgacatggtcaacgaggagcagaaaggctac
gcctacgggattcaaagtttcttagcaaatacgggcgcggtcgtggcggcgattctgccg
tttgtgtttgcgtatatcggtttggcgaacaccgccgagaaaggcgttgtgccgcagacc
gtggtcgtggcgttttatgtgggtgcggcgttgctggtgattaccagcgcgttcacgatt
ttcaaagtgaaggaatacgatccggaaacctacgcccgttaccacggcatcgatgtcgcc
gcgaatcaggaaaaagccaactggatcgaactcttgaaaaccgcgcctaaggcgttttgg
acggttactttggtgcaattcttctgctggttcgccttccaatatatgtggacttactcg
gcaggcgcgattgcggaaaacgtctggcacaccaccgatgcgtcttccgtaggttatcag
gaggcgggtaactggtacggcgttttggcggcggtgcagtcggttgcggcggtgatttgt
tcgtttgtattggcgaaagtgccgaataaataccataaggcgggttatttcggctgtttg
gctttgggcgcgctcggctttttctccgttttcttcatcggcaaccaatacgcgctggtg
ttgtcttataccttaatcggcatcgcttgggcgggcattatcacttatccgctgacgatt
gtgaccaacgccttgtcgggcaagcatatgggcacttacttgggcttgtttaacggctct
atctgtatgcctcaaatcgtcgcttcgctgttgagtttcgtgcttttccctatgctgggc
ggcttgcaggccactatgttcttggtagggggcgtcgtcctgctgctgggcgcgttttcc
gtgttcctgattaaagaaacacacggcggggtttga

DBGET integrated database retrieval system