KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0401Help
Entry
NMB0401           CDS       T00027                                 

Gene name
putA
Definition
(RefSeq) bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00250  Alanine, aspartate and glutamate metabolism
nme00330  Arginine and proline metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0401 (putA)
   00330 Arginine and proline metabolism
    NMB0401 (putA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     NMB0401 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     NMB0401 (putA)
Transcription factors [BR:nme03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    NMB0401 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg
Motif
Other DBs
NCBI-GeneID: 902515
NCBI-ProteinID: NP_273450
UniProt: Q9K0Z9
Position
complement(405844..409449)
Genome map
AA seq 1201 aa AA seqDB search
MFHFAFPAQTALRQAITDAYRRNEIEAVQDMLQRAQMSDEERNAASELARRLVTQVRAGR
TKAGGVDALMHEFSLSSEEGIALMCLAEALLRIPDNATRDRLIADKISDGNWKSHLNNSP
SLFVNAAAWGLLITGKLTATNDKQMSSALSRLISKGGAPLIRQGVNYAMRLLGKQFVTGQ
TIEEALQNGKEREKMGYRFSFDMLGEAAYTQADADRYYRDYVEAIHAIGKDAAGQGVYEG
NGISVKLSAIHPRYSRTQHGRVMGELLPRLKELFLLGKKYDIGINIDAEEANRLELSLDL
MEALVSDPDLAGYKGIGFVVQAYQKRCPFVIDYLIDLARRNNQKLMIRLVKGAYWDSEIK
WAQVDGLNGYPTYTRKVHTDISYLACARKLLSAQDAVFPQFATHNAYTLGAIYQMGKGKD
FEHQCLHGMGETLYDQVVGPQNLGRRVRVYAPVGTHETLLAYLVRRLLENGANSSFVNQI
VDENISIDTLIRSPFDTIAEQGIHLHNALPLPRDLYGKCRLNSQGVDLSNENVLQQLQEQ
MNKAAAQDFHAASIVNGKARDVGEAQPIKNPADHDDIVGTVSFADAALAQEAVGAAVAAF
PEWSATPAAERAACLRRFADLLEQHTPALMMLAVREAGKTLNNAIAEVREAVDFCRYYAN
EAEHTLPQDAKAVGAIVAISPWNFPLAIFTGEVVSALAAGNTVIAKPAEQTSLIAGYAVS
LMHEAGIPTSALQLVLGAGDVGAALTNDARIGGVIFTGSTEVARLINKALAKRGDNPVLI
AETGGQNAMIVDSTALAEQVCADVLNSAFDSAGQRCSALRILCVQEDVADRMLDMIKGAM
DELVVGKPIQLTTDVGPVIDAEAQQNLLNHINKMKGVAKSYHEVKTAADVDSKKSTFVRP
ILFELNNLNELQREVFGPVLHVVRYRADELDNVIDQINSKGYALTHGVHSRIEGTVRHIR
SRIEAGNVYVNRNIVGAVVGVQPFGGHGLSGTGPKAGGSFYLQKLTRAGEWVAPTLSQIG
QADEAALKRLEALVHKLPFNAEEKKAAAAALGHARIRTLRRAETVLTGPTGERNSISWHA
PKRVWIHGGSTVQAFAALTELAASGIQAVVEPDSPLASYTADLEGLLLVNGKPETAGISH
VAALSPLDSARKQELAAHDGALIRILPSENGLDILQVFEEISCSVNTTAAGGNASLMAVA
D
NT seq 3606 nt NT seq  +upstreamnt  +downstreamnt
atgtttcattttgcatttccggcacaaactgccctgcgccaagcgataaccgatgcctac
cgccgtaatgaaatcgaagccgtacaggatatgttgcaacgtgcacagatgagcgacgaa
gagcgcaacgccgcctccgagcttgcccgccgtttggttacccaagtccgcgccggccgc
accaaagccggcggcgtggatgcgctgatgcacgagttttcactctccagcgaagaaggc
atcgcgctgatgtgtctggcagaagccctgctgcgtatccccgacaacgccacgcgcgac
cgcctgattgccgacaagatttcagacggcaactggaaaagccatttgaacaacagccct
tccctcttcgtcaatgctgccgcctggggcctgctgattaccggcaaactgaccgccaca
aacgacaaacaaatgagttccgcactcagccgcctgatcagcaaaggcggcgcaccgctc
atccgccaaggcgtaaattacgccatgcggcttctgggcaaacagttcgtaaccggacag
accattgaagaagccctgcaaaacggcaaagaacgcgaaaaaatgggctaccgcttctcc
ttcgatatgttgggcgaagccgcctacacccaagccgatgccgaccgctactaccgcgac
tatgtcgaagccatccacgccatcggcaaagatgcggcaggacaaggcgtttacgaaggt
aacggtatttccgtcaaactttccgccatccatccgcgctactcgcgcacccaacacggc
cgcgtgatgggcgaactgttgccgcgcctgaaagagctgttccttttgggtaaaaaatac
gatatcggtatcaacatcgatgccgaagaagccaaccgtctggagctgtctttggatttg
atggaggctttggtttcagaccctgacttggctggctacaaaggtatcggtttcgttgtc
caagcctaccaaaaacgttgtccgttcgttatcgactacctgatcgaccttgcccgccgc
aacaaccaaaaactaatgatccgcctcgtcaaaggcgcgtattgggacagcgaaatcaaa
tgggcgcaagtggacggcttgaacggctatccgacctacacccgcaaagtccacaccgac
atctcctacctcgcctgcgcgcgcaaactgctttccgcgcaagacgcggtattcccgcaa
tttgccacccacaacgcctacactttgggcgcaatctaccaaatgggtaaaggcaaagat
tttgaacaccaatgcctgcacggtatgggcgaaaccctgtacgaccaagtcgtcggcccg
caaaacttaggccgccgcgtgcgcgtgtacgccccagtcggcacacacgaaaccctgctc
gcctacttggtgcgccgcctgttggaaaacggcgcgaactcgtctttcgtcaaccaaatc
gtcgatgaaaacatcagcatcgacacgctcatccgcagcccgttcgacaccatcgccgaa
caaggcatccacctgcacaacgccctgccgctgccgcgcgatttgtacggcaaatgccgt
ctgaactcgcaaggcgtggacttgagcaacgaaaacgtattgcagcagcttcaagaacag
atgaacaaagccgccgcgcaagacttccacgccgcatccatcgtcaacggcaaagcccgc
gatgtcggcgaagcgcaaccgattaaaaaccctgccgaccacgacgacatcgtcggcaca
gtcagctttgccgatgccgcgcttgcccaagaagcggttggcgcagccgttgccgcgttc
cccgaatggagtgcgacacctgccgccgaacgcgccgcctgcctgcgccgttttgccgat
ttgctggagcagcacaccccagcactgatgatgcttgccgtgcgcgaagcaggcaaaacg
ctgaacaacgccattgccgaagtgcgcgaagccgtcgatttctgccgctactacgcaaac
gaagccgaacataccctgcctcaagacgcaaaagccgtcggcgcgattgtcgccatcagc
ccgtggaacttcccgctcgccatctttaccggcgaagtcgtttccgcattggcggcaggc
aacaccgtcatcgccaaacccgccgaacaaaccagcctgattgccggttatgccgtttcc
ctcatgcacgaagccggcatcccgacttccgccctgcaactcgtcctcggcgcaggcgac
gtgggtgcggcattgaccaacgatgcccgcatcggcggcgtgattttcaccggctcgacc
gaagtggcgcgcctgatcaacaaagcccttgccaaacgcggcgacaatcccgtcctgatt
gccgaaaccggcggacaaaacgccatgattgtcgattccaccgcacttgccgagcaagtc
tgcgccgacgtattgaactccgccttcgacagcgcgggacaacgctgctccgccctgcgc
attttgtgcgtccaagaagacgttgccgaccgtatgctcgacatgatcaaaggcgctatg
gacgaactcgtcgtcggcaaaccgattcagctcactaccgatgtcggccccgtcatcgat
gccgaagcacagcaaaacctgttgaaccacatcaacaaaatgaaaggtgttgccaagtcc
taccacgaagtcaaaaccgccgccgatgtcgattccaaaaaatccacgttcgttcgcccc
atcctgtttgaattgaacaacctcaacgaactgcaacgcgaagtcttcggtcccgtcctg
cacgtcgtccgctaccgcgccgacgaactcgacaacgtcatcgaccaaatcaacagcaaa
ggctacgccctgacccacggcgtacacagccgcatcgaaggcacggtacgccacatccgc
agccgcatcgaagccggcaacgtttacgtcaaccgcaacatcgtcggcgcagtcgtcggc
gtacagcccttcggcggacacggtctgtccggcacaggccccaaagcaggcggttcgttc
tacctgcaaaaactgacccgcgccggcgaatgggttgccccgaccctgagccaaatcgga
caggcggacgaagccgcactcaaacgcctcgaagcactggttcacaaactaccgttcaac
gccgaagagaaaaaagccgcagcggccgctttgggacacgcccgcatccgcaccctgcgc
cgtgccgaaaccgtccttaccggaccgaccggcgagcgcaacagcatctcatggcacgcg
cccaaacgcgtttggatacacggcggcagcacggttcaagcctttgccgcactgaccgaa
cttgccgcctccggcatacaggcagtggtcgaacccgacagccccttggcttcctacact
gccgacttggaaggtctgctgctggtcaacggcaaacccgaaaccgccggcatcagccac
gttgccgccctgtcgcctttggacagcgcgcgcaaacaggaacttgccgcccacgacggc
gcactcatccgcatcctcccttcggaaaacggactcgacatcctgcaagtgtttgaagaa
atctcttgcagcgtcaacaccacagccgccggcggcaacgccagcctgatggcggtcgcc
gactga

DBGET integrated database retrieval system