KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0418Help
Entry
NMB0418           CDS       T00027                                 

Gene name
mraY
Definition
(RefSeq) phospho-N-acetylmuramoyl-pentapeptide-transferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
nme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0418 (mraY)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NMB0418 (mraY)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0418 (mraY)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     NMB0418 (mraY)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Glycosyltransferase
   NMB0418 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1 TLV_coat
Motif
Other DBs
NCBI-GeneID: 902534
NCBI-ProteinID: NP_273466
UniProt: Q9K0Y6
Position
426665..427747
Genome map
AA seq 360 aa AA seqDB search
MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTALKCGQAVRTDG
PQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWILLGVLLATGALGFYDDWRKVV
YKDPNGVSAKFKMVWQSSVAIIASLALFYLAANSANNILIVPFFKQIALPLGVVGFLVLS
YLTIVGTSNAVNLTDGLDGLATFPVVLVAAGLAIFAYASGHSQFAQYLQLPYVAGANEVV
IFCTAMCGACLGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMGGLFVVE
AVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLVLIGLSTLKIR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttttatggctcgcacatttcagcaactggttaaccggtctgaatatttttcaatac
accacattccgcgccgtcatggcggcgttgaccgccttagcgttttccctgatgttcggc
ccgtggacgatacgcaggctgaccgcgctcaaatgcgggcaggcagtgcgtaccgacggt
ccgcaaacccacctcgtcaaaaacggcacgccgacgatgggcggttcgctgattctgacc
gccattaccgtgtccaccctgttgtggggcaactgggcaaacccgtatatctggattctc
ttgggcgtattgctcgccacgggcgcactcggtttttacgacgactggcgcaaagtcgtc
tataaagaccccaacggcgtgtccgccaaattcaaaatggtgtggcagtcaagcgttgcc
attatcgccagtttggcattgttttaccttgccgccaattccgccaacaatattttgatt
gtcccgttcttcaaacaaatcgccctgccgctgggcgtggtcggctttttggtgttgtct
tacctgaccatcgtcggcacatccaatgccgtcaacctcaccgacggcttggacggcctt
gcgaccttccccgtcgtcctcgttgccgccggcctcgccatcttcgcctatgccagcggc
cactcacaatttgcccaatacctgcaattaccttacgttgccggcgcaaacgaagtggtg
attttctgtaccgccatgtgcggcgcgtgcctcggtttcttgtggtttaacgcctatccc
gcgcaagtctttatgggcgatgtcggtgcattggcattgggtgccgcgctcggtaccgtc
gccgttatcgtccgccaagagtttgtcctcgtcattatgggcggattatttgtcgtagaa
gccgtatccgttatgcttcaggttggctggtataagaaaaccaaaaaacgcatcttcctg
atggcgcccatccatcaccactacgaacaaaaaggctggaaagaaacccaagtcgtcgtc
cgcttttggattattaccatcgtcttggtgttgatcggtttgagtaccctcaaaatccgc
tga

DBGET integrated database retrieval system