KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0420Help
Entry
NMB0420           CDS       T00027                                 

Gene name
murD
Definition
(RefSeq) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00471  D-Glutamine and D-glutamate metabolism
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NMB0420 (murD)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0420 (murD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0420 (murD)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     NMB0420 (murD)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Amino acid ligase
   NMB0420 (murD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 902536
NCBI-ProteinID: NP_273468
UniProt: Q9K0Y4
Position
428553..429890
Genome map
AA seq 445 aa AA seqDB search
MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKPERVSQIGKMFDGLVFYTGRL
KDALDNGFDILALSPGISERQPDIEAFKQNGGRVLGDIELLADIVNRRDDKVIAITGSNG
KTTVTSLVGYLCIKCGLDTVIAGNIGTPVLEAEWQREGKKADVWVLELSSFQLENTESLR
PTAATVLNISEDHLDRYDDLLDYAHTKAKIFRGDGVQVLNADDAFCRAMKRAGREVKWFS
LEHEADFWLERETGRLKQGNEDLIVTQDIPLQGLHNAANVMAAVALCEAIGLSREALLEH
VKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILGGMGKGQDFTP
LRDALVGKAKGVFLIGVDAPQIRRDLDGCGLNMTDCATLGEAVQTAYAQAEAGDIVLLSP
ACASFDMFKGYAHRSEVFIEAFKAL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacttttcaaaacaaaaaaatcctcgtcgccggactcggcggtacgggtatttccatg
attgcctacctgcgcaaaaacggcgcggaggttgctgcgtatgatgcggagctgaagccg
gaacgcgtgtcgcaaatcggtaagatgtttgacgggttggtgttttacacgggccgtctg
aaagatgcgctggacaacggtttcgatattctggctctcagtcccggcatcagcgagcgg
cagccggatattgaggcgttcaagcaaaacggcggacgcgtgttgggcgacatcgaattg
ctggcggacattgtgaaccgccgggacgacaaggtaattgcgattaccggcagcaacggc
aaaaccacggtaacgagcctggtcggctatctctgtatcaagtgcgggctggataccgtt
atcgcgggcaatatcggcacgccggttttggaggcggaatggcagcgcgaaggcaaaaag
gcggacgtgtgggtgttggagctttccagcttccaactggaaaacaccgaaagcctgcgt
ccgactgcggcgacggtgctgaacatttccgaagaccatctcgaccgctacgacgacttg
ctcgactatgcgcataccaaagccaagattttccgtggcgacggcgtgcaggttttgaat
gcggacgatgcgttctgccgcgcgatgaagcgtgccgggcgcgaggtaaaatggttttcg
ttggaacacgaagctgatttctggttggaacgcgagacaggccgcctgaaacaaggcaat
gaagatttgattgtcacgcaagacattccgttgcaaggtctgcacaacgccgctaacgtc
atggctgccgtggctttgtgtgaggccatcggtttgtcgcgcgaagcattgctcgaacac
gtcaaaaccttccaaggcctgccgcaccgcgtggaaaaaatcggcgagaaaaacggcgtg
gtgtttatcgacgacagcaaaggcacgaatgtcggcgcgactgccgccgcgattgccggt
ttgcaaaatccgctcttcgtgattttgggcggcatgggtaaagggcaggacttcacgccc
ctgcgcgatgcactggtaggcaaggcaaaaggcgtgttcttgattggtgtcgatgcgccg
caaatccgccgcgatttggacggctgcggcttgaatatgaccgactgcgccactttggga
gaagccgttcagacggcatatgcccaagccgaagcaggcgatattgtgttgctcagcccc
gcctgcgcgagctttgatatgttcaaaggctacgcgcaccgttcggaagtgtttatcgaa
gcgtttaaggctttgtga

DBGET integrated database retrieval system