KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0422Help
Entry
NMB0422           CDS       T00027                                 

Gene name
murG
Definition
(RefSeq) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
nme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0422 (murG)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NMB0422 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0422 (murG)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     NMB0422 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Glycosyltransferase
   NMB0422 (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_transf_28 Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 902538
NCBI-ProteinID: NP_273470
UniProt: Q9K0Y2
Position
431345..432412
Genome map
AA seq 355 aa AA seqDB search
MGGKTFMLMAGGTGGHIFPALAVADSLRARGHHVIWLGSKDSMEERIVPQYGIRLETLAI
KGVRGNGIKRKLMLPVTLYQTVREAQRIIRKHRVECVIGFGGFVTFPGGLAAKLLGVPIV
IHEQNAVAGLSNRHLSRWAKRVLYAFPKAFSHEGGLVGNPVRADISNLPVPAERFQGREG
RLKILVVGGSLGADVLNKTVPQALALLPDNARPQMYHQSGRGKLGSLQADYDALGVKAEC
VEFITDMVSAYRDADLVICRAGALTIAELTAAGLGALLVPYPHAVDDHQTANARFMVQAE
AGLLLPQTQLTAEKLAEILGGLNREKCLKWAENARTLALPHSADDVAEAAIACAA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtaaaacctttatgctgatggcgggcggaacgggcggacatattttccccgcg
ctggcggtggcggattcattgcgcgcgcgcggccatcatgtgatttggctgggcagcaag
gattcgatggaagagcgtatcgtgccgcaatacggcatacgcttggaaacgctggcgatt
aaaggcgtgcgcggcaacggcatcaaacgcaaactgatgctgccggttactttgtatcaa
accgtccgcgaagcgcagcggattatccgcaaacaccgtgtcgagtgcgtcatcggcttc
ggcggcttcgttaccttccccggcggtttggcggcgaagctattaggcgtgccgattgtg
attcacgagcaaaacgccgtggcaggtttgtccaaccgccacctgtcgcgctgggcgaag
cgggtgttgtacgcttttccgaaagcgttcagccacgaaggcggcttggtcggcaacccc
gtccgcgccgatattagcaacctgcccgtgcctgccgaacgcttccaagggcgtgaaggc
cgtctgaaaattttggtggtcggcggcagtttgggcgcggacgttttgaacaaaaccgta
ccgcaggcattggctttgctgcccgacaatgcgcgtccgcagatgtaccaccaatcggga
cggggcaagctgggcagcttgcaggcggattacgacgcgctgggcgtgaaagccgaatgc
gtggaatttattaccgacatggtgtccgcctaccgcgatgccgatttggtgatttgccgt
gccggcgcgctgacgattgccgagttgacggcggcgggattgggtgcgttgttagtgccg
tatcctcacgcggttgacgatcaccaaaccgccaacgcgcgttttatggtgcaggcggag
gcgggattgctgttgccgcaaacccagttgacggcggaaaaactcgccgagattctcggc
ggcttaaaccgcgaaaaatgcctcaaatgggcagaaaacgcccgtacgttggcactgccg
cacagtgcggacgacgtggcggaagccgcgattgcgtgtgcggcgtaa

DBGET integrated database retrieval system