KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0424Help
Entry
NMB0424           CDS       T00027                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00473  D-Alanine metabolism
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
nme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NMB0424 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0424 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    NMB0424 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0424 (ddl)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NMB0424 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Amino acid ligase
   NMB0424 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-GeneID: 902540
NCBI-ProteinID: NP_273472
UniProt: Q9K0Y0
Position
434089..435003
Genome map
AA seq 304 aa AA seqDB search
MQNFGKVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTA
FNILHGTYGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH
DDTDFDAVEEKLGLPMFVKPAAEGSSVGVVKVKGKGRLKSVYEELKHLQGEIIAERFIGG
GEYSCPVLNGKGLPGIHIIPATEFYDYEAKYNRDDTIYQCPSEDLTEAEESLMRELAVRG
AQAIGAEGCVRVDFLKDTDGKLYLLEINTLPGMTSHSLVPKSAAVTGVGFADLCIEILKT
AHVG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttggcaaagtggccgtattgatgggcggtttttccagcgaacgagaaatc
tcgctggacagcggcaccgccattttgaatgctttaaaaagcaaaggcatagacgcatac
gccttcgatcctaaagaaaccccattgtctgaattgaaggcacaaggttttcagacggca
ttcaacatccttcacggtacttacggcgaagacggggcggttcagggtgcattggaactg
ttgggcattccctataccggcagcggtgtcgccgcatccgccatcggcatggacaaatac
cgctgcaaactgatttggcaggcattgggattgcccgttcccgagttcgccgtcctgcac
gacgacactgatttcgatgccgtcgaagaaaaattgggcctgccgatgtttgtgaaaccg
gcggccgaaggcagcagcgtaggcgtggtaaaagtcaaaggaaaaggccgtctgaaaagc
gtttacgaagaattgaaacaccttcagggcgaaatcattgccgaacgttttatcggcggc
ggcgaatattcctgccccgtcctgaacggcaaagggctgcccggcatacacatcattccc
gcaaccgagttttacgactacgaagccaagtacaaccgcgacgacaccatttatcaatgt
ccttcggaagatttgaccgaagccgaagaaagcctgatgcgcgaactggcggttcgcggc
gcgcaggcaatcggtgcggaaggctgcgtgcgcgtcgatttcctcaaagataccgacggc
aaactctatctgttggaaatcaacaccctgcccggtatgacgagccatagtttagtaccg
aaatccgctgccgttacgggcgtgggttttgccgatttatgtattgaaattttgaagacc
gcacatgtgggataa

DBGET integrated database retrieval system