KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0424Help
Entry
NMB0424           CDS       T00027                                 

Gene name
ddl
Definition
(RefSeq) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00473  D-Alanine metabolism
nme00550  Peptidoglycan biosynthesis
nme01100  Metabolic pathways
nme01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    NMB0424 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMB0424 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    NMB0424 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0424 (ddl)
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     NMB0424 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Amino acid ligase
   NMB0424 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_Ter ATP-grasp_3 RimK ATPgrasp_ST ATPgrasp_YheCD TTL
Motif
Other DBs
NCBI-GeneID: 902540
NCBI-ProteinID: NP_273472
UniProt: Q9K0Y0
Position
434089..435003
Genome map
AA seq 304 aa AA seqDB search
MQNFGKVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLSELKAQGFQTA
FNILHGTYGEDGAVQGALELLGIPYTGSGVAASAIGMDKYRCKLIWQALGLPVPEFAVLH
DDTDFDAVEEKLGLPMFVKPAAEGSSVGVVKVKGKGRLKSVYEELKHLQGEIIAERFIGG
GEYSCPVLNGKGLPGIHIIPATEFYDYEAKYNRDDTIYQCPSEDLTEAEESLMRELAVRG
AQAIGAEGCVRVDFLKDTDGKLYLLEINTLPGMTSHSLVPKSAAVTGVGFADLCIEILKT
AHVG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcagaattttggcaaagtggccgtattgatgggcggtttttccagcgaacgagaaatc
tcgctggacagcggcaccgccattttgaatgctttaaaaagcaaaggcatagacgcatac
gccttcgatcctaaagaaaccccattgtctgaattgaaggcacaaggttttcagacggca
ttcaacatccttcacggtacttacggcgaagacggggcggttcagggtgcattggaactg
ttgggcattccctataccggcagcggtgtcgccgcatccgccatcggcatggacaaatac
cgctgcaaactgatttggcaggcattgggattgcccgttcccgagttcgccgtcctgcac
gacgacactgatttcgatgccgtcgaagaaaaattgggcctgccgatgtttgtgaaaccg
gcggccgaaggcagcagcgtaggcgtggtaaaagtcaaaggaaaaggccgtctgaaaagc
gtttacgaagaattgaaacaccttcagggcgaaatcattgccgaacgttttatcggcggc
ggcgaatattcctgccccgtcctgaacggcaaagggctgcccggcatacacatcattccc
gcaaccgagttttacgactacgaagccaagtacaaccgcgacgacaccatttatcaatgt
ccttcggaagatttgaccgaagccgaagaaagcctgatgcgcgaactggcggttcgcggc
gcgcaggcaatcggtgcggaaggctgcgtgcgcgtcgatttcctcaaagataccgacggc
aaactctatctgttggaaatcaacaccctgcccggtatgacgagccatagtttagtaccg
aaatccgctgccgttacgggcgtgggttttgccgatttatgtattgaaattttgaagacc
gcacatgtgggataa

DBGET integrated database retrieval system