KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0430Help
Entry
NMB0430           CDS       T00027                                 

Gene name
prpB
Definition
(RefSeq) 2-methylisocitrate lyase
  KO
K03417  methylisocitrate lyase [EC:4.1.3.30]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    NMB0430 (prpB)
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.30  methylisocitrate lyase
     NMB0430 (prpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase ICL ComA
Motif
Other DBs
NCBI-GeneID: 902546
NCBI-ProteinID: NP_273478
UniProt: Q9K0X5
Position
440420..441298
Genome map
AA seq 292 aa AA seqDB search
MMSQHSAGARFRQAVKESNPLAVAGCVNAYFARLATQSGFKAIYLSGGGVAACSCGIPDL
GITTMEDVLIDARRITDNVDTPLLVDIDVGWGGAFNIARTIRNFERAGVAAVHIEDQVAQ
KRCGHRPNKAIVSKDEMVDRIKAAVDARVDENFVIMARTDALAVEGLDAAIERAQACVEA
GADMIFPEAMTDLNMYRQFADAVKVPVLANITEFGSTPLYTQSELAENGVSLVLYPLSSF
RAASKAALNVYEAIMRDGTQAAVVDSMQTRAELYEHLNYHAFEQKLDKLFQK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgatgagtcaacactctgccggagcacgtttccgccaagccgtgaaagaatcgaatccg
cttgccgtcgccggttgcgtcaatgcttattttgcacgattggccacccaaagcggtttc
aaagccatctatctgtccggcggcggcgtggcagcctgttcttgcggtatccctgatttg
ggcattaccacaatggaagatgtgctgatcgacgcacgacgcattacggacaacgtggat
acgcctctgctggtggacatcgatgtgggttggggcggtgcattcaatattgcccgtacc
attcgcaactttgaacgcgccggtgttgcagcggttcacatcgaagatcaggtagcgcaa
aaacgctgcggccaccgtccgaacaaagccattgtatctaaagatgaaatggtcgaccgt
atcaaagctgccgtagatgcgcgcgttgatgagaacttcgtgattatggcgcgtaccgat
gcgctggcggtagaaggtttggatgccgctatcgaacgcgcccaagcttgtgtcgaagcc
ggtgcggacatgattttccctgaagccatgaccgatttgaacatgtaccgccaatttgca
gatgcggtgaaagtgcccgtgttggcgaacattaccgagtttggttccactccgctttat
acccaaagcgagctggctgaaaacggcgtgtcgctggtgctgtatccgctgtcatcgttc
cgtgcagcaagcaaagccgctctgaatgtttacgaagcgattatgcgcgatggcactcag
gcggcggtggtggacagtatgcaaacccgtgccgagctgtacgagcatctgaactatcat
gccttcgagcaaaaactggataaattgtttcaaaaatga

DBGET integrated database retrieval system