KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0431Help
Entry
NMB0431           CDS       T00027                                 

Gene name
pprC
Definition
(RefSeq) 2-methylcitrate synthase
  KO
K01659  2-methylcitrate synthase [EC:2.3.3.5]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00640  Propanoate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    NMB0431 (pprC)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.5  2-methylcitrate synthase
     NMB0431 (pprC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Citrate_synt
Motif
Other DBs
NCBI-GeneID: 902547
NCBI-ProteinID: NP_273479
UniProt: Q7DDQ3
Position
441384..442538
Genome map
AA seq 384 aa AA seqDB search
MTETTQTPTLKPKKSVALSGVAAGNTALCTVGRTGNDLSYRGYDILDLAQKCEFEEVAHL
LIHGHLPNKFELAAYKTKLKSMRGLPIRVIKVLESLPAHTHPMDVMRTGVSMLGCVHPER
ESHPESEARDIADKLIASLGSILLYWYQYSHNGKRIEVESDEETIGGHFLQLLHGKRPSE
SHIKAMHVSLILYAEHEFNASTFTARVIAGTGSDMYSSITGAIGALKGPKHGGANEVAYD
IQKRYRNADEAEADIRERIGRKEIVIGFGHPVYTISDPRNVVIKEVARGLSKETGDMRLF
DIAERLESVMWEEKKMFPNLDWFSAVSYQKLGVPTAMFTPLFVISRTTGWSAHVLEQRKD
GKIIRPSANYTGPEDLAFVEIEER
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaactactcaaaccccgaccctcaaacctaaaaaatccgttgcgctttctggc
gttgcggccggtaataccgctttgtgtaccgttggccgtaccggcaacgatttgagctat
cgcggttacgacattctggatttggcacaaaaatgcgagtttgaagaagtcgcccacctg
ctgattcacggccatctgcccaacaaattcgagctggccgcttataaaaccaagctcaaa
tccatgcgcggcctgcctatccgtgtgattaaagttttggaaagcctgcctgcacatacc
catccgatggacgtaatgcgtaccggcgtatccatgctgggctgcgttcatcctgaacgt
gaaagccatccggaaagtgaagcgcgcgacatcgccgacaaactgatcgccagcctcggc
agcatcctcttgtactggtatcaatattcgcacaacggcaaacgcattgaggttgaaagc
gacgaagagaccatcggcggtcatttcctgcaactgttgcacggcaaacgcccaagcgaa
tcacacatcaaagccatgcacgtttcactgattctgtatgccgaacacgagttcaacgct
tctacctttaccgcccgcgtgatcgccggtacaggctctgatatgtactccagcattacc
ggagcaatcggcgcgttgaaaggtccgaaacacggcggcgcgaacgaagtggcttacgat
attcaaaaacgctaccgcaatgccgacgaagctgaagccgacatccgcgaacgcatcggc
cgcaaagaaatcgtgatcggtttcggtcatccggtgtacaccatttccgaccctcgcaac
gttgtcattaaagaagtggcacgcggtttgagcaaagaaaccggcgatatgcgcctcttt
gacattgccgaacgtttggaaagcgtgatgtgggaagagaaaaaaatgttcccgaatctg
gactggttctctgccgtttcctaccaaaaattgggcgtaccgaccgctatgttcacaccg
ctgttcgtaatttcccgtacaaccggttggagcgcacacgttcttgagcaacgcaaagac
ggcaaaatcatccgtccgagcgcaaactacacaggccctgaagatttggcgtttgtggag
attgaagaacgataa

DBGET integrated database retrieval system