KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0435Help
Entry
NMB0435           CDS       T00027                                 

Gene name
ackA-1
Definition
(RefSeq) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00430  Taurine and hypotaurine metabolism
nme00620  Pyruvate metabolism
nme00640  Propanoate metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Module
nme_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0435 (ackA-1)
   00640 Propanoate metabolism
    NMB0435 (ackA-1)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB0435 (ackA-1)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    NMB0435 (ackA-1)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     NMB0435 (ackA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 902551
NCBI-ProteinID: NP_273483
UniProt: Q9K0X1
Position
448549..449748
Genome map
AA seq 399 aa AA seqDB search
MSDQLILVLNCGSSSLKGAVIDRKSGSVVLSCLGERLTTPEAVITFNKDGNKRQVPLSGR
NCHAGAVGMLLNELEKHGLHDRIKAIGHRIAHGGEKYSESVLIDQAVMDELNACIPLAPL
HNPANISGILAAQEHFPGLPNVGVMDTSFHQTMPERAYTYAVPRELRKKYAFRRYGFHGT
SMRYVAPEAARILGKPLEDIRMIIAHLGNGASITAIKNGKSVDTSMGFTPIEGLVMGTRC
GDIDPGVYSYLTSHAGMDVAQVDEMLNKKSGLLGISELSNDCRTLEIAADEGHEGARLAL
EVMTYRLAKYIASMAVGCGGVDALVFTGGIGENSRNIRAKTVSYLDFLGLHIDTKANMEK
RYGNSGIISPTDSSPAVLVVPTNEELMIACDTAELAGIL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaccaactcatcctcgttctgaactgcggcagttcatcgctcaaaggcgccgtt
atcgaccgaaaaagcggcagcgtcgtcctaagctgcctcggcgaacgcctgaccacgccc
gaagccgtcattacgttcaacaaagacggcaacaaacgccaagttcccctgagcggccga
aattgccacgccggcgcggtgggtatgcttttgaacgaactggaaaaacacggtctgcac
gaccgcatcaaagccatcggccaccgcatcgcccacggcggcgaaaaatacagcgagtct
gttttgatcgaccaggccgtaatggacgaactcaatgcctgcattccgcttgcgccgctg
cacaaccccgccaacatcagcggcatccttgccgcacaggaacatttccccggtctgccc
aatgtcggcgtgatggatacttcgttccaccaaaccatgccggagcgtgcctacacttat
gccgtgccgcgcgagttgcgtaaaaaatacgctttccgccgctacggtttccacggcacc
agtatgcgttacgttgcccctgaagccgcacgcatcttgggcaaacctctggaagacatc
cgcatgattattgcccacttaggcaacggcgcatccattaccgccatcaaaaacggcaaa
tccgtcgataccagtatgggtttcacgccgatcgaaggtttggtaatgggtacacgttgc
ggcgacatcgatccgggcgtatacagctatctgacttcccacgccgggatggatgttgcc
caagtggatgaaatgctgaacaaaaaatcaggtttgctcggtatttccgaactttccaac
gactgccgcaccctcgaaatcgccgccgacgaaggccacgaaggcgcgcgcctcgccctc
gaagtcatgacctaccgcctcgccaaatacatcgcttcgatggctgtgggctgcggcggc
gttgacgcactcgtgttcaccggcggtatcggcgaaaactcgcgtaatatccgtgccaaa
accgtttcctatcttgatttcttgggtctgcacatcgacaccaaagccaatatggaaaaa
cgctacggcaattcgggcattatcagcccgaccgattcttctccggctgttttggttgtc
ccgaccaatgaagaactgatgattgcctgcgacactgccgaacttgccggcatcttgtag

DBGET integrated database retrieval system