KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0440Help
Entry
NMB0440           CDS       T00027                                 

Definition
(RefSeq) prephenate dehydrogenase
  KO
K00210  prephenate dehydrogenase [EC:1.3.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme00401  Novobiocin biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0440
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB0440
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.12  prephenate dehydrogenase
     NMB0440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDH NAD_binding_2 F420_oxidored ApbA TrkA_N Sacchrp_dh_NADP IlvN
Motif
Other DBs
NCBI-GeneID: 902556
NCBI-ProteinID: NP_273488
UniProt: Q9K0W6
Position
complement(453095..453967)
Genome map
AA seq 290 aa AA seqDB search
MPILNHIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGVIDQASVAIDA
DSIGGADLVLIATPVATVPAILTALRPVLPEHTWISDVGSTKSSVIEAFRRCLPDRLHHC
IAAHPIAGSDRSGAQAAQFGLFRHRKLIITPHGGEHSDGIALVENLWHAVGAEIYTMDAQ
RHDAVFAAVSHMPHLTAFAYVHQILDHPDGQEYLKFAATGFRDFTRIASGHPAVWADICL
ANKDSLLQLVQGLGKQLDVLANILTTDDREALYRYFEEAKTTRDRWLDGN
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcccattttgaaccatattgccctcatcggtgtagggctgatcggcggttcgttcgtt
ctcgacctcaaaaggcagggactcgtccgcaccgttaccggtatcgacaccgaccgcgac
aacctcgaacgtgcattggaacgcggcgtgattgaccaggcttccgttgccatcgacgcg
gacagcatcggcggtgcggacttggtactgattgccacgcccgtcgccaccgttcccgcc
attttgaccgcgctgcgccccgttttgccggaacacacttggatttccgatgtcggcagc
accaaatcttcggtcatcgaagccttccgccgctgtctgcccgaccgcctgcaccactgc
atcgccgcccacccaattgccggttcggacagaagcggtgcgcaagccgcgcagttcggg
ctgttccgccacagaaaactcatcatcacgccacacggcggcgaacattcagacggcatt
gccttggtagaaaacctgtggcacgcggtcggtgcggaaatttatacgatggacgcgcaa
cgccacgacgcggttttcgccgccgtctcccatatgccccacctgaccgccttcgcctat
gtccaccagattctcgaccaccccgacggacaggaatatctgaaattcgccgccacgggc
tttcgggacttcacccgcatcgcctccggtcatcccgccgtgtgggcggacatctgcctt
gccaacaaagacagcctgctgcaactggttcaaggcttgggcaaacagttggacgttttg
gcaaacatcctgaccaccgacgaccgcgaagccctgtaccgctattttgaagaagccaaa
accacacgcgaccgctggctggacggcaactga

DBGET integrated database retrieval system