KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0446Help
Entry
NMB0446           CDS       T00027                                 

Gene name
pheA
Definition
(RefSeq) chorismate mutase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
nme_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0446 (pheA)
Enzymes [BR:nme01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     NMB0446 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     NMB0446 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2 ACT YjgF_endoribonc ACT_4
Motif
Other DBs
NCBI-GeneID: 902562
NCBI-ProteinID: NP_273493
UniProt: Q9K0W1
Position
460670..461758
Genome map
AA seq 362 aa AA seqDB search
MSQTIDELLLPHRNAIDTIDAEILRLLNERAQHAHAIGELKGTGAVYRPEREVAVLRRIQ
DLNKGPLPDESVARLFREVMSECLAVERPLTIAYLGPQGTFTQQAAIKHFGHAAHTMACP
TIDDCFKQVETRQADYLVAPVENSTEGSVGRTLDLLAVTALQACGEIVLRIHHNLLRKNN
GSTEGIAKVFSHAQALAQCNDWLGRHLPNAERIAVSSNAEAARLVAESDDGTVAAIAGRT
AAEIYGLDMVAECIEDEPNNTTRFLVMGHHETGASGSDKTSLAVSAPNRAGAVASLLQPL
TESGISMTKFESRPSKSVLWEYLFFIDIEGHRRDAQIQTALERLGERASFVKVIGSYPTA
VL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaaactatcgacgaactcctccttccccaccgcaacgccatcgacaccatcgat
gccgaaatcctgcgcctgctcaacgaacgtgcgcaacacgcccacgccatcggcgagctg
aaaggcacgggcgcagtgtaccgccccgaacgcgaagtcgccgtgttgcgccgcattcag
gatttgaacaaaggcccgctgcccgacgaatcggtagcacgcctgtttcgggaagtgatg
agcgagtgcctcgccgtcgaacgcccgctgaccatcgcctatctggggccgcagggcacg
tttacccagcaggcggcaatcaaacatttcggacacgccgcgcacaccatggcgtgtccg
accatagacgactgcttcaagcaggttgaaacgcgtcaggcggattatctggtcgccccc
gtggaaaattcgaccgaaggctcggtcggtcgcacgttagacctgcttgccgttaccgcg
ttgcaggcgtgcggcgaaatcgttttgcgcatccaccacaaccttttgcgtaaaaacaac
ggcagcaccgaaggcattgccaaagtcttttcccacgcgcaggcgttggcgcagtgcaac
gactggttgggcagacacctgcccaacgccgaacggattgccgtgtccagcaatgccgaa
gccgcaaggctggttgccgaatcggacgacggtacggttgccgccatcgccggacgcacg
gcggcggaaatctacggactcgatatggttgccgagtgcatcgaagacgaaccgaacaac
accacgcgcttcttggtgatgggacatcacgaaaccggtgcaagcggcagcgacaagact
tcgctggccgtttccgcgcccaaccgggcaggcgcggttgcctcgctgctgcaaccgctg
accgaatcgggtatttccatgaccaagtttgagagccgtccgagcaaatccgttttgtgg
gaatacctgttcttcatcgacatcgaaggacaccgccgggacgcgcagattcagacggca
ttggaacgcttgggcgaacgcgcttcgttcgtcaaagtcatcggttcgtacccgaccgcc
gttttgtag

DBGET integrated database retrieval system