KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0456Help
Entry
NMB0456           CDS       T00027                                 

Gene name
amiC
Definition
(RefSeq) N-acetylmuramoyl-L-alanine amidase
  KO
K01448  N-acetylmuramoyl-L-alanine amidase [EC:3.5.1.28]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme01503  Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:nme00001]
 09160 Human Diseases
  09168 Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    NMB0456 (amiC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0456 (amiC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:nme03036]
    NMB0456 (amiC)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.28  N-acetylmuramoyl-L-alanine amidase
     NMB0456 (amiC)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Peptidoglycan biosynthesis and degradation
  Amidase
   NMB0456 (amiC)
Chromosome and associated proteins [BR:nme03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    NMB0456 (amiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase_3 AMIN Tape_meas_lam_C
Motif
Other DBs
NCBI-GeneID: 902572
NCBI-ProteinID: NP_273503
UniProt: Q9K0V3
Position
complement(468331..469581)
Genome map
AA seq 416 aa AA seqDB search
MIKLTRRQIIRRTAGTLFALSPIASAVAKTVRAPQFTAARIWPSHTYTRLTLESTAALKY
QHFTLDNPGRLVVDIQNANINTVLHGLSQKVMADDPFIRSIRAGQNTPTTVRLVIDLKQP
THAQVFALPPVGGFKNRLVVDLYPHGMDADDPMMALLNGSLNKTLRGSPEADLAQNTTPQ
PGRGRNGRRPVIMLDPGHGGEDPGAISPGGLQEKHVVLSIARETKNQLEALGYNVFMTRN
EDVFIPLGVRVAKGRARRADVFVSIHADAFTSPSARGTGVYMLNTKGATSSAAKFLEQTQ
NNADAVGGVPTSGNRNVDTALLDMTQTATLRDSRKLGKLVLEELGRLNHLHKGRVDEANF
AVLRAPDMPSILVETAFLSNPAEEKLLGSESFRRQCAQSIASGVQRYINTSVLKRG
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaactgacacgaagacaaatcatccgccgcaccgccggcacactgttcgcccta
agccccatcgcatccgccgttgccaaaacggtacgcgccccgcaattcaccgccgcacgg
atatggccgtcgcacacctacacccgcctgacgctggaaagcaccgccgcgctcaaatac
cagcacttcacgctcgacaacccgggcaggctggtcgtcgacatacaaaacgcgaacatc
aataccgtattgcacggactgtctcagaaagtcatggcagacgacccctttatccgcagc
atacgcgcgggtcagaacacgccgaccaccgtccgcctcgtcatcgatttgaaacagccc
acccacgcacaagtcttcgcgcttccgcccgtcggcggctttaagaaccgcctcgtcgtc
gacctctatccgcacgggatggatgccgacgatccgatgatggcactgctcaacggtagc
ctgaataaaaccctgcgcggctctcccgaagccgacctcgcccaaaacaccacgccccaa
cccgggcgcggcagaaacgggcgcagacccgtcatcatgctcgatccgggacacggcggt
gaagaccccggcgccatcagcccgggcggtctacaggaaaaacatgtcgtcctatccatt
gccagggaaaccaaaaatcagttggaagcattaggttacaatgtatttatgacgcgcaac
gaagacgtgttcatcccattgggcgtgcgtgtcgccaaagggcgagcacggcgggcggac
gtatttgtctccatccacgccgatgccttcaccagcccctccgcgcgcggcacgggggtt
tatatgttaaacaccaaaggcgcaaccagctctgccgccaaattcttggaacagacgcaa
aacaatgccgacgcggtcggcggcgtaccgaccagcggcaaccgcaatgtcgataccgcc
ctgctcgacatgacccaaaccgccacgctgcgcgacagccgcaaactcggcaaactggtg
cttgaagaattgggcaggctcaaccatctgcacaaaggcagggtggacgaagccaatttc
gccgttttgcgcgcacccgatatgccgtctatcctggtcgaaaccgccttcctgtccaat
cctgccgaagagaagctgctgggcagcgaatccttccgccggcagtgcgcccaatccatt
gcctcgggtgtccaacgctacatcaatacatccgtattgaagcggggttga

DBGET integrated database retrieval system