KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0458Help
Entry
NMB0458           CDS       T00027                                 

Gene name
murI
Definition
(RefSeq) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00471  D-Glutamine and D-glutamate metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    NMB0458 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
    NMB0458 (murI)
Enzymes [BR:nme01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     NMB0458 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:nme01011]
 Precursor biosynthesis
  Racemase
   NMB0458 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race MSP1a Gin
Motif
Other DBs
NCBI-GeneID: 902574
NCBI-ProteinID: NP_273505
UniProt: P0A0R0
Position
470241..471053
Genome map
AA seq 270 aa AA seqDB search
MENIGRQRPIGVFDSGIGGLTNVRALMERLPMENIIYFGDTARVPYGTKSKATIENFSMQ
IVDFLLEHDVKAMVIACNTIAAVAGQKIRQKTGNMPVLDVISAGAKAALATTRNNKIGII
ATNTTVNSNAYARAIHRNNPDTLVRTQAAPLLVPLVEEGWLEHEVTRLTVCEYLKPLLAD
GIDTLVLGCTHFPLLKPLIGREAGNVALVDSAITTAEETARVLAQEGLLNTDNNNPDYRF
YVSDIPLKFRTIGERFLGRTMEQIEMVSLG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatatcggcaggcagcgacccatcggcgtttttgactcgggaatcggcggtttg
accaatgtgcgagcgctgatggaacggctgccgatggagaacatcatttatttcggcgac
acggcgcgcgtgccttacgggacgaaatctaaggcgaccatcgaaaatttctcgatgcag
attgtcgattttttattggaacacgatgtcaaggcgatggttatcgcgtgcaatacgatt
gcggcggtggcggggcagaaaatccgtcaaaaaaccggcaatatgcccgttttggacgtg
atttccgccggcgcgaaagccgcgctggcaacgacgcgcaacaataaaatcggcattatc
gccaccaatacgacagtcaacagcaatgcttatgcgcgcgccatccataggaacaacccc
gacacgctcgtccgcacgcaggccgcgccgctgctcgtccctttggtggaagagggctgg
ctggaacacgaagttacccgcctgaccgtatgcgaatacctcaaaccattgcttgcagac
ggcatcgatacgctggtgttgggctgcacgcactttcccttgctcaagcccttaatcggc
agggaggcgggcaatgtcgcgttggttgattctgcaattacaacggccgaagaaaccgca
cgcgtccttgctcaggaaggattgctcaataccgacaacaacaatcccgactaccgtttt
tacgtcagcgatattcctttgaaattcagaaccatcggcgagcgttttctgggcaggacg
atggagcagattgaaatggtgtctttgggttaa

DBGET integrated database retrieval system