KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0466Help
Entry
NMB0466           CDS       T00027                                 

Gene name
aspS
Definition
(RefSeq) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00970  Aminoacyl-tRNA biosynthesis
Module
nme_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    NMB0466 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB0466 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB0466 (aspS)
   03029 Mitochondrial biogenesis [BR:nme03029]
    NMB0466 (aspS)
Enzymes [BR:nme01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     NMB0466 (aspS)
Amino acid related enzymes [BR:nme01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   NMB0466 (aspS)
Transfer RNA biogenesis [BR:nme03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    NMB0466 (aspS)
 Prokaryotic Type
   Other AARSs
    NMB0466 (aspS)
Mitochondrial biogenesis [BR:nme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMB0466 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b
Motif
Other DBs
NCBI-GeneID: 902582
NCBI-ProteinID: NP_273513
UniProt: Q9K0U5
Position
485743..487551
Genome map
AA seq 602 aa AA seqDB search
MRTNYCGLISEQYLDQTVTVKGWVHRRRDHGGVIFIDLRDREGIVQVVIDPDTPEAFAAA
DSSRNEYVLSITGRVRNRPEGTTNDKMISGKIEILAKEIEVLNAAATPPFQIDDENISEN
VRLTNRVIDLRRPVMQRNLRLRYQVAMGVRRYLDAQGFIDIETPMLTRSTPEGARDYLVP
SRVHPGEFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLETSFL
NEDEIMDITEGMAKQVFKDALNVDLGDFPRMPYSEAMFYYGSDKPDMRINLKFTELTDLM
KTEEFKVFRGAADMKGGRVVALRVPNGAEFSRKEIDEYTKFVGIYGAKGLAYIKVNDVSN
LSNGEDSGLQSPIVKYLSENALKEIIARTGAQNGDIIFFGADKAKVVNEAIGALRIKVGL
EHGKDNGYFTDEWKPLWVVDFPMFEYDEEADRYVAVHHPFTAPKEGHEDLMVSDPANCLA
RAYDMVLNGWEIGGGSIRIHRADVQEKVFAALKISPEEQQEKFGFLLDNLKFGAPPHGGL
AFGLDRLVTLMTGAESIRDVIAFPKTQRAQCLLTNAPNSVDDKQLRELSLRLRQKATETK
EV
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaccaactattgcggcctgatcagtgagcaatacttagaccaaaccgttaccgtc
aaaggctgggtacaccgtcgacgcgaccacggcggtgtgatttttatcgacctgcgcgac
cgcgaaggcatcgtccaagtcgtgatcgatcccgacacgcccgaagcgtttgccgctgcc
gattcctcccgcaacgaatacgttttgagcattaccggccgcgtacgcaaccgtcccgaa
ggcacgaccaacgataaaatgatttccggcaaaatcgaaatccttgccaaagaaatcgaa
gtcttgaacgccgccgccacgccgccgttccaaatcgacgatgaaaacatcagcgaaaac
gttcgcctgaccaaccgcgttatcgacttgcgccgtccggtgatgcaacgcaacctgcgc
ctgcgttaccaagttgctatgggcgttcgccgctacttggacgcgcaaggtttcatcgac
attgaaaccccgatgctgacccgctccacgcctgaaggcgcgcgcgactacctcgtgccg
agccgcgttcatccgggcgagtttttcgcgctaccgcaatcgccgcaattattcaaacaa
ctgttgatggtggcgggtttcgaccgttactaccaaatcaccaagtgcttccgcgacgaa
gacctgcgtgccgaccgccagcccgaatttacccaaatcgacttggaaacctcgttctta
aacgaggatgaaatcatggacatcactgaaggcatggccaaacaagtcttcaaagatgct
ttaaatgtagatttgggcgacttcccacgcatgccttactctgaagccatgttctactac
ggctctgacaaaccggatatgcgcatcaacttgaaatttaccgagttgaccgacctgatg
aaaacggaagaattcaaagtcttccgtggcgcagccgacatgaaaggcggccgcgtggtc
gctctgcgcgtgccgaacggcgcagaattcagccgcaaagaaatcgacgaatacaccaaa
tttgtcggcatctacggcgcgaaaggtctggcatacatcaaagtaaacgatgtcagcaac
ctttccaacggcgaagacagcggcctgcaatctccaatcgtgaaatacctgtccgaaaac
gccctgaaagaaattatcgcgcgtaccggcgcgcaaaacggcgacatcatcttcttcggc
gcagacaaagccaaagtcgtgaacgaagccatcggcgcactgcgtatcaaagtcggcttg
gagcacggcaaagacaacggctatttcacagacgaatggaaacctttgtgggtcgttgat
ttcccaatgttcgaatacgacgaagaagccgaccgctacgttgccgtacaccatccgttt
accgcgccaaaagaaggtcatgaagacctgatggtttccgacccggcaaattgtttggca
cgcgcctacgatatggtattgaacggctgggaaatcggcggcggctctatccgtattcac
cgcgcagacgtacaagagaaagtgtttgccgcgctgaaaatcagccctgaagagcaacaa
gagaaattcggcttcctcttggacaacctgaaattcggcgcacctcctcacggcggtctt
gcattcggcctcgaccgtctggtaacgctgatgaccggtgccgaatccatccgcgacgtg
attgccttcccgaaaacacaacgcgcccaatgcctgctgaccaacgcgcccaacagcgtg
gacgacaagcagttgcgtgaattaagtttgcgtttgcgccagaaggcaaccgaaactaaa
gaagtataa

DBGET integrated database retrieval system