KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0469Help
Entry
NMB0469           CDS       T00027                                 

Gene name
speE
Definition
(RefSeq) agmatinase
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00330  Arginine and proline metabolism
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    NMB0469 (speE)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     NMB0469 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 902585
NCBI-ProteinID: NP_273516
UniProt: P60654
Position
490144..491067
Genome map
AA seq 307 aa AA seqDB search
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSGRSGARFGPEA
IRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDSRDFVEKMEAHAGKLLSSGKR
CLSLGGDHFITLPLLRAHARYFGKLALIHFDAHTDTYDNGSEYDHGTMFYTAPKEGLIDP
SRSVQIGIRTEHSKKLPFTVLSAPKVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSF
APGTGTPVCGGLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacagcacactggcaggacaaaccgacaactccctcgtttccaataatttcggg
tttttgcgcctgccgcttaattttatgccgtatgaaagtcatgccgattgggttattacc
ggcgtgccttatgatatggcggtttcagggcgttccggcgcgcgtttcggtcctgaagcc
atccggcgcgcctccgtcaacctcgcttgggagcaccgcaggtttccatggacatttgat
gtgcgcgaacgcctgaacattattgattgcggcgacttggttttttcttttggcgacagc
agggattttgtcgaaaaaatggaagcgcacgccggcaaattactttcttccggcaaacgc
tgtttgagtttgggcggcgaccatttcattaccctaccgttgttgcgcgcccacgcccgc
tatttcggcaaactcgcactgattcattttgacgcgcacaccgacacctacgacaacggc
agcgaatacgaccacggtacgatgttctataccgcccccaaggaaggcctcatcgacccg
tcccgttccgtacaaatcggcatacgcaccgaacacagtaaaaaattgccttttactgtg
ttgtccgcccctaaagtcaatgaagacagtgttgaagagaccgtccgtaaaatcaaagaa
accgtcggcaatatgcccgtttacctgactttcgacatagactgcctggacccgtcgttc
gcccctgggaccggtacgcccgtatgcggcggcttgagcagcgacagggcattaaaaatc
ctacgtgggctgacggatctcgacatcgtcggtatggatgttgtagaagttgccccctct
tacgaccaatccgacattaccgctttggccggtgccacaattgccttggaaatgctttac
cttcaaggtgcgaaaaaggactga

DBGET integrated database retrieval system