KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0470Help
Entry
NMB0470           CDS       T00027                                 

Definition
(RefSeq) C4-dicarboxylate transporter
  KO
K03319  divalent anion:Na+ symporter, DASS family
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    NMB0470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_sulph_symp CitMHS
Motif
Other DBs
NCBI-GeneID: 902586
NCBI-ProteinID: NP_273517
UniProt: Q9K0U2
Position
491265..492731
Genome map
AA seq 488 aa AA seqDB search
MMKLGFKPIPLAIAAVLCALVLALPVPDGVKPQAWTLLAMFVGVIAAIIGKAMPLGALSI
IAVGLVAVTGVTADKPGAAMSDALSAFANPLIWLIAIAVMISRGLLKTGLGMRIGYLFIA
VFGRKTLGIGYSLALSELLLAPVTPSNTARGGGIIHPIMQSIAGSYGSNPAKGTEGKMGK
YLALVNYHSNPISSAMFITATAPNPLIVNLIAENLGSSFRLSWGAWAWAMAVPGVIAFFV
MPLILYFLYPPEIKETPNAVQFAKDRLREMGKMSADEIIMAVIFGILLLLWADVPALITG
NHAFSINATATAFIGLSLLLLSGVLTWDDVLKEKSAWDTIIWFGALIMMAAFLNKLGLIK
WFSGVLAESVGGLGVSGTAAGVILVLAYMYAHYMFASTTAHITAMFGAFFAAAVSLNAPA
MPTALMMAAASNIMMTLTHYATGTSPVIFGSGYTTMGEWWKAGFIMSVVNFLIFFVIGSI
WWKVLGYW
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaattgggtttcaaaccgatacccctcgccattgccgcagtattgtgcgccctg
gttttggcactgcccgtacccgacggggtcaagcctcaggcttggacgctgctggccatg
tttgtcggtgtgattgccgccattatcggcaaggccatgccgttgggcgcgctgtcgatt
attgccgtcgggttggtcgcagtaaccggcgtaaccgccgacaaaccgggcgcggcgatg
agcgatgcgttgagtgcgttcgccaatccgttgatttggctgattgccatcgcagttatg
atttcgcgcggtttgctcaaaacagggctggggatgcgtatcggatatttgtttatcgcc
gtttttggaagaaaaacgctgggcatcggttacagtctcgctctttccgaactgctgctg
gctcccgttaccccttccaataccgcgcgcggcggcggcattatacatccgattatgcag
tcgattgccggcagttacggctccaatcccgcaaaaggcacagaaggcaagatgggtaaa
tatttggctttggtcaactatcattccaatcccatttcgtcggctatgtttattactgca
actgcccccaaccctttaatcgtcaacttgattgccgaaaatttaggcagtagtttccgt
ctttcttggggggcgtgggcgtgggcaatggctgttcccggcgttatcgcctttttcgtt
atgcctttgattttatattttttgtatccgcctgaaattaaagaaacgcccaatgccgtt
caatttgccaaagaccgtctgagggagatgggtaaaatgtcggcagacgaaatcattatg
gcggtcattttcggtatcttgctgctgttgtgggcagatgttcccgcccttattaccggc
aatcacgcttttagtatcaacgccaccgccaccgcatttatcggattaagcctgcttttg
ctttccggtgtattgacttgggacgatgttttgaaagaaaaaagcgcgtgggatacgatt
atttggtttggcgcattgattatgatggccgcatttttaaataaactcggactgattaaa
tggttctccggagtgttggcggaaagtgtcggcggtttgggcgttagcggcacggctgcg
ggcgtaatcctcgtgcttgcttatatgtatgcgcattatatgtttgccagtactactgca
catattaccgctatgttcggcgcatttttcgctgctgccgtttcactgaatgccccggcg
atgccgaccgcgctgatgatggcggccgcatccaacattatgatgaccctcactcattat
gcgaccggtacttcgcctgtgattttcggttcgggctacaccacaatgggagaatggtgg
aaggcgggttttatcatgagcgtagtcaattttctgatttttttcgttatcggcagcatt
tggtggaaagttctggggtattggtaa

DBGET integrated database retrieval system