KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0472Help
Entry
NMB0472           CDS       T00027                                 

Gene name
bioF
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00780  Biotin metabolism
nme01100  Metabolic pathways
Module
nme_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    NMB0472 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB0472 (bioF)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     NMB0472 (bioF)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class II
   NMB0472 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 902588
NCBI-ProteinID: NP_273519
UniProt: Q9K0U0
Position
494237..495379
Genome map
AA seq 380 aa AA seqDB search
MKVFKQQLEQLGAQNQYRSIPDLIHQGRYITRENRKMLNMSSNDYLGLASDENLRRSFLQ
QYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFNSGYHANLGILPALTTT
KSLILADKFVHASMIDGIRLSRCAFFRYRHNDYEHLKNLLEKNVGKFDRTFIVTESVFSM
DGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKA
LASVGAYAVCNQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLS
AFLRREVAHRTQIMPSQTCIVPYILGGNEATLAKAEYLQRQGYYCLPIRPSTVPKNTSRI
RLSLTADMTTDEVRQFAACL
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtttttaaacaacagcttgaacaactcggcgcgcaaaaccaatatcgttcgatt
ccggatttgattcatcaagggcggtatattacgcgggaaaaccgcaaaatgctgaatatg
tcgtctaatgattatttgggtttggcatcagatgaaaacttgcgccggtcttttttgcag
caatacggcggtaattttccctcttttaccagttcttcatcgcgtttattaacgggcaac
tttcctatttataccgatttggaagagcttgtcgcacaacgtttccaacgggaaagcgcg
ttattgttcaacagcggctatcacgccaatctcggtattttgcctgctttgacgacgacg
aaaagtttgattttggcagataaatttgttcacgccagtatgattgacggcatccgtttg
agccggtgtgcgtttttccgttatcgtcataatgattatgaacatttgaaaaatctgctt
gaaaaaaacgtcggaaaatttgaccgcacttttatcgttaccgaatctgttttcagtatg
gacggcgatgtggcggatttgaaacagcttgtccaattaaaaaaacagtttcccaatact
tatctttatgtggatgaagcccacgcaatcggtgtttatgggcaaaacggattggggatt
gccgaacgggataatttgattgccgagattgatttattggttggcactttcggtaaagcc
ttagcctcggtgggggcgtatgccgtctgcaaccaagtattgaaagaatgtttgattaat
caaatgcgcccattgattttttcaaccgcattgccgccgtttaatgtggcttggacttat
tttatttttgaacgattgccgcaattctcaaaagaaagaagccatcttgagcagttaagc
gcatttttacggcgggaagtggcgcatcggacgcaaataatgccgagccaaacctgtatc
gtcccctatattttaggcgggaatgaagccacccttgccaaagcggaatacctgcaaagg
cagggttattattgcctgcccatcagaccgtcgacagtacccaaaaacacatccagaatc
cgcctgtctttaacggcagatatgacaacggatgaagtgcggcagtttgcggcgtgcctg
taa

DBGET integrated database retrieval system