KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0525Help
Entry
NMB0525           CDS       T00027                                 

Definition
(RefSeq) 7-cyano-7-deazaguanine synthase QueC
  KO
K06920  7-cyano-7-deazaguanine synthase [EC:6.3.4.20]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB0525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB0525
Enzymes [BR:nme01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.20  7-cyano-7-deazaguanine synthase
     NMB0525
Transfer RNA biogenesis [BR:nme03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NMB0525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QueC NAD_synthase Asn_synthase ATP_bind_3 Arginosuc_synth DSBA
Motif
Other DBs
NCBI-GeneID: 902640
NCBI-ProteinID: NP_273570
UniProt: Q9K0Q9
Position
546273..546932
Genome map
AA seq 219 aa AA seqDB search
MSNQQALVIFSGGQDSTTCLIQAIQTYGRENVQAITFQYGQRHAVELERARWIAQDLGVK
QTVLDLSLMRQITHNALMDDTAAIETAENGVPNTFVDGRNALFLLYAAIYAKGQGIRHII
AGVCETDFSGYPDCRDVFVKSMNVTLNLAMDYDFQIHTPLMYLTKAQTWALADEMGVLDY
IREQTHTCYNGIVGGCRECPSCILRERGLAEYLESKKAV
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaccaacaagccttggtcatcttttcgggcggtcaggattcgaccacctgcctg
attcaggcaatccaaacctacgggcgcgaaaacgtccaagccattactttccaatacggg
caacgccatgccgtcgagctggaacgtgcccgctggattgcgcaggatttgggcgtcaaa
caaaccgtactcgacttgagcctgatgcggcagattacgcacaatgccctgatggacgac
accgccgccatcgaaactgccgaaaacggcgttccgaatacctttgtagacggccgcaac
gcgcttttcctgctctatgccgcgatttacgccaaagggcaggggatacggcacatcatc
gcgggcgtgtgcgaaaccgacttctccggctatcccgactgccgcgacgtgtttgtcaaa
tcgatgaacgttacccttaatttggcgatggactatgattttcaaatccacacgccgctg
atgtatctgaccaaggcgcaaacgtgggcgttggcggacgaaatgggcgtgctggactat
atccgcgagcaaacccacacctgctataacggcatcgtcggcggctgccgcgaatgcccg
agctgtatcttgcgcgaacgcgggctggcggaatatctggaaagtaaaaaggccgtctga

DBGET integrated database retrieval system