KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0527Help
Entry
NMB0527           CDS       T00027                                 

Definition
(RefSeq) 6-pyruvoyl tetrahydrobiopterin synthase
  KO
K01737  6-pyruvoyltetrahydropterin/6-carboxytetrahydropterin synthase [EC:4.2.3.12 4.1.2.50]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
nme01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB0527
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB0527
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.50  6-carboxytetrahydropterin synthase
     NMB0527
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     NMB0527
Transfer RNA biogenesis [BR:nme03016]
 Prokaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    NMB0527
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTPS
Motif
Other DBs
NCBI-GeneID: 902642
NCBI-ProteinID: NP_273572
UniProt: Q9K0Q7
Position
547485..547907
Genome map
AA seq 140 aa AA seqDB search
MKITKIFTFDSSHMLDGHDGKCQNLHGHTYKLEITVSDGIIKGGAKDGMVMDFTDLKAIV
KQHITDPFDHAFIYHGGNSRECQIAALLEGWNMKTLRLPCRTTAENMAVEMYGRLKNAGL
NVCRVKLWETPTSCAEYEGE
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaccaaaatcttcaccttcgactcctcgcatatgctcgacgggcatgacggc
aaatgccaaaacctgcacggacatacctacaaactcgaaatcaccgtttcagacggcatt
atcaaaggcggcgcgaaagacggtatggtgatggactttaccgacttgaaagccattgtc
aaacaacacattaccgaccccttcgaccacgccttcatctaccacggcggcaacagccgc
gaatgccaaatcgccgcgcttttggagggctggaacatgaaaaccctgcgcctgccctgc
cgcaccactgccgaaaatatggcggtcgaaatgtacggccgtctgaaaaacgcggggctg
aacgtgtgccgcgtgaaattgtgggaaacgccgacatcgtgtgcggagtatgaaggggag
tag

DBGET integrated database retrieval system