KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0537Help
Entry
NMB0537           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K06189  magnesium and cobalt transporter
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0537
Transporters [BR:nme02000]
 Other Transporters
  Others
   NMB0537
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CorC_HlyC CBS
Motif
Other DBs
NCBI-GeneID: 902652
NCBI-ProteinID: NP_273582
UniProt: Q9K0P8
Structure
PDB: 

Position
complement(559022..559846)
Genome map
AA seq 274 aa AA seqDB search
MDGAQPKTNFFERLIARLAREPDSAEDVLNLLRQAHEQEVFDADTLLRLEKVLDFSDLEV
RDAMITRSRMNVLKENDSIERITAYVIDTAHSRFPVIGEDKDEVLGILHAKDLLKYMFNP
EQFHLKSILRPAVFVPEGKSLTALLKEFREQRNHMAIVIDEYGGTSGLVTFEDIIEQIVG
EIEDEFDEDDSADNIHAVSSERWRIHAATEIEDINTFFGTEYSSEEADTIGGLVIQELGH
LPVRGEKVLIGGLQFTVARADNRRLHTLMATRVK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggacggcgcacaaccgaaaacgaatttttttgaacgcctgattgcccgactcgcccgc
gaacccgattccgccgaagacgtattaaacctgcttcggcaggcgcacgagcaggaagtt
tttgatgcggatacgcttttaagattggaaaaagtcctcgatttttccgatttggaagtg
cgcgacgcgatgattacgcgcagccgtatgaacgttttaaaagaaaacgacagcatcgag
cgcatcaccgcctacgttatcgataccgcccattcgcgcttccccgtcatcggcgaagac
aaagacgaagttttgggcattttgcacgccaaagacctgctcaaatatatgtttaacccc
gagcagttccacctcaaatccattctccgccccgccgtcttcgtccccgaaggcaaatcg
ctgaccgcccttttaaaagagttccgcgaacagcgcaaccatatggcgattgtcatcgac
gaatacggcggcacatccggcttggtcacctttgaagacatcatcgagcaaatcgtcggc
gaaatcgaagacgagtttgacgaagacgatagcgccgacaatatccatgccgtttcttcc
gaacgctggcgcatccatgcagctaccgaaatcgaagacatcaacaccttcttcggcacg
gaatacagcagcgaagaagccgacaccattggcggcctggtcattcaagagttgggacat
ctgcccgtgcgcggcgaaaaagtccttatcggcggtttgcagttcaccgtcgcacgcgcc
gacaaccgccgcctgcatacgctgatggcgacccgcgtgaagtaa

DBGET integrated database retrieval system