KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0539Help
Entry
NMB0539           CDS       T00027                                 

Gene name
hemC
Definition
(RefSeq) porphobilinogen deaminase
  KO
K01749  hydroxymethylbilane synthase [EC:2.5.1.61]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00860  Porphyrin and chlorophyll metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
Module
nme_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0539 (hemC)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.61  hydroxymethylbilane synthase
     NMB0539 (hemC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Porphobil_deam Porphobil_deamC LysR_substrate
Motif
Other DBs
NCBI-GeneID: 902654
NCBI-ProteinID: NP_273584
UniProt: Q9K0P6
Position
560482..561417
Genome map
AA seq 311 aa AA seqDB search
MNPKKLVIASRESLLAMWQAKHIQGRLKALYPDCEVEILGMTTRGDQILDKTLSKVGGKG
LFVKELEQALYDGRADLAVHSIKDVPMDLPEGFALAAIGERANPFDAFVSNQYTRLEEMP
EGAVVGTSSLRREAQLRARYPHLLIKPLRGNVQTRLSKLDNGEYDAIILAAAGLQRLKLD
GRIRMILSESDSLPAAGQGALGIEIAAHREDLYEVLKPLNHGVTNACVTAERALARALGG
SCQVPLAAYCTEENGLLTLRGLVGHPDGSVVLRADAQAPAEYADALGRAVAKKLADDGAR
ELIGAVLNTEN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgaaaaaactcgtcatcgccagccgcgaaagcctgcttgctatgtggcaggca
aagcatatccaaggccgtctgaaggctctgtatcccgattgcgaagtcgagattttgggc
atgaccacgcgcggcgatcagattttggacaaaactttgtcaaaagtcggcggtaaaggc
ttgtttgtcaaagagttggaacaggctttatatgacgggcgcgccgatttggcggtgcat
tcgattaaggacgtgccgatggatttgcctgaaggtttcgcgcttgccgccatcggcgaa
cgcgccaatccgtttgacgcgtttgtgtccaaccaatacacgcgtttggaagaaatgccc
gaaggcgcggttgtcggcacatccagcctgcgccgcgaagcccagttgcgtgcgcgctat
ccgcatttgcttatcaaacctttgcgcggcaatgtgcaaacccgtttgtccaaactcgat
aacggcgaatacgacgcaattatcttggctgccgccggtttgcagcgtctgaaattggac
ggacgcatccgcatgattttgtcggaatccgacagcctgcctgccgccggacaaggcgca
ttgggtatcgaaattgccgcgcaccgcgaagatttgtatgaagttttgaaacccttgaac
cacggtgttaccaatgcctgcgttaccgccgaacgcgccctcgcacgcgctttgggcgga
agctgccaagtgcctttggccgcatattgcacggaagaaaacggcttgctgaccttgcgc
ggcttggtcggacaccccgacggttcggttgtgttgcgggcggacgcgcaagcccctgcc
gaatatgccgacgcgctcggacgcgctgtcgctaagaaattggcggacgacggtgcgcgg
gaattgattggagcagtattgaatacggaaaattga

DBGET integrated database retrieval system