KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0540Help
Entry
NMB0540           CDS       T00027                                 

Gene name
aspC
Definition
(RefSeq) aromatic amino acid aminotransferase
  KO
K00813  aspartate aminotransferase [EC:2.6.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00220  Arginine biosynthesis
nme00250  Alanine, aspartate and glutamate metabolism
nme00270  Cysteine and methionine metabolism
nme00330  Arginine and proline metabolism
nme00350  Tyrosine metabolism
nme00360  Phenylalanine metabolism
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme00401  Novobiocin biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01210  2-Oxocarboxylic acid metabolism
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0540 (aspC)
   00270 Cysteine and methionine metabolism
    NMB0540 (aspC)
   00220 Arginine biosynthesis
    NMB0540 (aspC)
   00330 Arginine and proline metabolism
    NMB0540 (aspC)
   00350 Tyrosine metabolism
    NMB0540 (aspC)
   00360 Phenylalanine metabolism
    NMB0540 (aspC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0540 (aspC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    NMB0540 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nme01007]
    NMB0540 (aspC)
Enzymes [BR:nme01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     NMB0540 (aspC)
Amino acid related enzymes [BR:nme01007]
 Aminotransferase (transaminase)
  Class I
   NMB0540 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 902655
NCBI-ProteinID: NP_273585
UniProt: Q9K0P5
Position
complement(561821..563014)
Genome map
AA seq 397 aa AA seqDB search
MFFKHIEAAPADPILGLGEAFKAETRPEKVNLGIGVYKDASGATPLVKAVKEAEKRLLES
ETTKNYLTIDGVADYNAQTQILLFGKDHEIIASRRAKTAQSLGGTGALRIAAEFAKRQLN
AQTIWISNPTWPNHNAIAKAVGIQDKPYRYYDAAKHGLDWDGMIEDLSQAQKGDIVLLHG
CCHNPTGIDPTPEQWETLAKLSAEKGWLPLFDFAYQGFGNGLEEDAYGLRVFLKHNTELL
IASSYSKNFGMYNERVGAFTLVAEDEETAARAHSQVKTIIRTLYSNPASHGANTIALVLK
NDDLKAQWIAELDEMRGRIKAMRQKFVGLLKAKGASQNFDFIIKQNGMFSFSGLTPEQVD
RLKNEFAIYAVRSGRINVAGITDNNIDYLCESIVKVL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcaagcacatcgaagccgcccccgccgatccgattctcggtttgggcgaagcg
ttcaaagccgaaacccgccccgaaaaagtcaacctcggcatcggcgtttataaagacgca
tccggcgcgacacccctcgtcaaagccgtcaaagaagccgaaaaacgcctgttggaaagc
gaaaccaccaaaaactacctcaccatcgacggcgttgccgactacaacgcgcaaacccaa
atcctgctgttcggcaaagaccacgaaatcatcgccagccgtcgcgccaaaacagcgcaa
agcctcggcggtacgggcgcattgcgtattgcggccgagtttgccaaacgccagttgaac
gcgcaaaccatctggatttccaatccgacttggcccaaccacaacgccatcgccaaagcg
gtcggtatccaagacaaaccttatcgttactatgatgccgccaaacacggtttggattgg
gacggcatgattgaggacttgagccaagcgcaaaaaggcgacatcgtcctgctgcacggc
tgctgccacaatcctaccggcatcgaccctacgcccgaacaatgggaaactttggcaaaa
ctttctgccgaaaaaggctggttgccgctgtttgactttgcctaccaaggcttcggcaat
ggtttggaagaagatgcctacggcttgcgcgtgttcttgaaacacaatacagaattgctg
attgccagctcttattccaaaaacttcggtatgtacaacgagcgcgtcggcgcgttcact
ttggtggccgaagatgaagaaacagcagcccgcgcccacagccaagtcaaaaccatcatc
cgtaccttgtattccaacccggcttcacacggtgcgaacaccattgcgctggtgttgaaa
aatgatgatttgaaagcacaatggattgccgaactcgatgaaatgcgcggccgcatcaaa
gccatgcgccaaaaatttgtcgggttgctcaaagccaaaggtgcaagccaaaactttgat
ttcattatcaaacaaaacggtatgttctctttcagcggcttgactcccgaacaagtcgac
cgcctgaaaaacgagtttgccatttatgccgtccgctccggccgcatcaacgtcgccggc
attaccgacaacaacatcgattatctgtgcgaaagcatcgtgaaagtactgtaa

DBGET integrated database retrieval system