KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0546Help
Entry
NMB0546           CDS       T00027                                 

Gene name
adhP
Definition
(RefSeq) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00010  Glycolysis / Gluconeogenesis
nme00071  Fatty acid degradation
nme00350  Tyrosine metabolism
nme00625  Chloroalkane and chloroalkene degradation
nme00626  Naphthalene degradation
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01130  Biosynthesis of antibiotics
nme01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMB0546 (adhP)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    NMB0546 (adhP)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    NMB0546 (adhP)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMB0546 (adhP)
   00626 Naphthalene degradation
    NMB0546 (adhP)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMB0546 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N DUF2237 Methyltransf_31
Motif
Other DBs
NCBI-GeneID: 902661
NCBI-ProteinID: NP_273591
UniProt: Q9K0P0
Position
complement(570557..571597)
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEVIEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSGVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtaatcgaacgcgag
gttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttgggacac
gaaggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcttggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgttccgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgtatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggatcctgcg
caagcttccagcattacttgtgccggtgtaaccacttataaagccattaaagtttccggc
gttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgacgacaaa
ctggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccatc
gggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggccgtatggtgatcgatatgaaaaaagaatgc
ggctgcggccatcaccactga

DBGET integrated database retrieval system