KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0547Help
Entry
NMB0547           CDS       T00027                                 

Definition
(RefSeq) type IV pilin protein
  KO
K02655  type IV pilus assembly protein PilE
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nme02044]
    NMB0547
   02035 Bacterial motility proteins [BR:nme02035]
    NMB0547
Secretion system [BR:nme02044]
 Type II secretion system
  Pilin secretion/fimbrial assembly protein
   NMB0547
Bacterial motility proteins [BR:nme02035]
 Pilus system
  Pilus assembly proteins
   NMB0547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ComP_DUS N_methyl SUR7 HTH_18
Motif
Other DBs
NCBI-GeneID: 902662
NCBI-ProteinID: NP_273592
UniProt: Q9K0N9
Structure
PDB: 

Position
complement(571886..572275)
Genome map
AA seq 129 aa AA seqDB search
MKNVQKGFTLLELMIAVAILGILTLITYPSYKTYIRRVRLSEVRTTLLHNAQTMERYYRQ
KGTFKTYDKNKLKQNEYFDITLSEVSPDHFTLQADPNPTTNDGETCVVTLNDGGTIAASG
TNQSCPGFD
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgttcaaaaaggctttacgctgctcgagctgatgattgccgtcgccatcctc
ggcatcctgacgctcatcacctacccttcctataaaacctacatccggcgcgtccgcctg
tcggaagtcaggacgaccctgctgcacaacgcgcagaccatggaacgttactaccgccaa
aaagggacgtttaaaacctacgacaaaaacaaactgaaacaaaacgaatatttcgatatc
actttaagcgaagtcagccccgaccactttacccttcaggccgaccccaatcccaccacc
aacgacggcgaaacctgcgtcgttacgctcaacgacggcggtaccattgccgcttccggt
acaaaccaatcctgccccggcttcgactaa

DBGET integrated database retrieval system