KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0559Help
Entry
NMB0559           CDS       T00027                                 

Gene name
ubiB
Definition
(RefSeq) ubiquinone biosynthesis protein UbiB
  KO
K03688  ubiquinone biosynthesis protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99987 Cofactor metabolism
    NMB0559 (ubiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC1 Pkinase APH
Motif
Other DBs
NCBI-GeneID: 902674
NCBI-ProteinID: NP_273603
UniProt: Q9K0N0
Position
586971..588482
Genome map
AA seq 503 aa AA seqDB search
MKWLKRLTVIVGTFYRYRLAGLCASLMGSGWICALLKMMPQSSKLKNEPPAVRLRLALES
LGPIFIKFGQVLSTRPDLIPHDYAVELAKLQDKVPPFDARLSREQIEKSLGQSIEKLYAE
FETEPIASASIAQVHKARLHSGEQVAVKVLRPNLLPVIEQDLSLMRFGAGWVERLFADGK
RLKPREVVAEFDKYLHDELDLMREAANASQLGRNFQNSDMLIVPKVFYDYCTSDVLTIEW
MDGTPVSDIAKLKADGIDLHKLADYGVEIFFTQVFRDGFFHADMHPGNILVAADNRYIAL
DFGIVGTLTDYDKRYLAINFLAFFNRDYRRVATAHIESGWVPADTRAEELEAAVRAVCEP
VFNKPISQISFGLVLMRLFEVSRRFNVEIQPQLVLLQKTLLNIEGLGRQLDPDLDLWKTA
KPFLVKWMNGQVGPKALWRNLKNEAPDWAQIIPSLPRKISALIDENRQQEMRDAYIHLVK
VQQRQSLWLAVIAVVLLLILLLK
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttgaaacgcctgacggttattgtcgggactttttaccgctatcggctggca
ggtctgtgtgcttcgctgatgggtagcggttggatatgcgctctgctgaaaatgatgccg
cagtcgtccaaattgaaaaacgaaccgcctgctgtccgtctgcgccttgccttggaaagc
ctggggccgattttcatcaagttcgggcaggttttgtccacacgccccgatttgattccg
cacgattacgccgtcgaactggcaaagctgcaagacaaagtgccgccttttgacgcgcgg
ctttcgcgtgaacaaatcgaaaaatcgttgggtcagtccatcgaaaagctgtatgcggaa
tttgaaaccgagcccatcgccagcgcgtccatcgcccaagtacacaaagcccgcctgcat
tcgggcgaacaagtggcggttaaagttttgcgccccaaccttttgcccgtgatcgaacag
gatttgtcgctgatgcgctttggtgcaggctgggtcgagcgtctgtttgccgacggcaag
cgtctgaagccgcgcgaagtggtggcggagttcgacaaatatctgcacgacgagttggac
ttgatgcgcgaagccgccaatgccagccagctcggacgcaatttccaaaacagcgatatg
ctgattgtgccgaaggtgttttacgactactgcaccagcgacgtgctgaccatcgaatgg
atggacggcacgccggtttccgacatcgccaaactcaaagcagacggcatcgatttgcac
aaactcgccgattacggcgtggaaatcttcttcacgcaagtcttccgcgacggctttttc
cacgcggatatgcaccccggcaatattttggttgccgccgacaaccgctacatcgccctc
gatttcggcatcgtcggcacgctgaccgattacgacaaacgttatctcgccatcaacttc
ctcgccttcttcaaccgcgattaccggcgcgtcgccaccgcccacatcgaatcgggctgg
gtgcccgccgacacgcgcgcggaagagttggaagcggctgtccgcgccgtgtgcgaacca
gtgttcaacaaaccgatttcgcagatttccttcggcttggtgctgatgcgcctgtttgaa
gtcagccgccgcttcaatgtcgaaatccagccgcagctggtattgctgcaaaaaacgctg
ctcaacatcgaaggcttgggacggcagcttgatcccgatttggacttgtggaaaaccgcc
aaaccgtttttggtgaaatggatgaacgggcaggtcggccctaaagccctttggcgcaac
ctcaaaaacgaagcccccgactgggcgcaaatcatcccttcattgccgcgcaaaatcagt
gcgttgattgatgaaaaccgccagcaggaaatgcgtgatgcctatatccatttggtcaaa
gtgcagcagcggcaaagcctgtggctggctgtgattgcggttgttttgctgctgattttg
cttttgaaatag

DBGET integrated database retrieval system