KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0560Help
Entry
NMB0560           CDS       T00027                                 

Gene name
cysE
Definition
(RefSeq) serine acetyltransferase
  KO
K00640  serine O-acetyltransferase [EC:2.3.1.30]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00270  Cysteine and methionine metabolism
nme00920  Sulfur metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
nme01230  Biosynthesis of amino acids
Module
nme_M00021  Cysteine biosynthesis, serine => cysteine
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    NMB0560 (cysE)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    NMB0560 (cysE)
Enzymes [BR:nme01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.30  serine O-acetyltransferase
     NMB0560 (cysE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SATase_N Hexapep Hexapep_2
Motif
Other DBs
NCBI-GeneID: 902675
NCBI-ProteinID: NP_273604
UniProt: Q7DDN0
Position
complement(588839..589657)
Genome map
AA seq 272 aa AA seqDB search
MKKDHLNTTGFDLWHTIREETAAAVSAEPMLASFLHQTVLRHESLGSVLAYHLSSKLGSP
IMDVRALFEIYQQALGSDTQIGKCVEADLKAIYERDPACDEYSLPLLYFKGFHAIQAHRI
NHRLYLDGRKTLAYFLQNRMSEVFGVDIHPAARFGYGLMLDHATGFVAGETAVLGNNISI
LHGVTLGGSGKEGGDRHPKIGDGVMIGANASILGNIRIGSNAKIGAGSVVVSDVPPSITV
VGVPAKPVARSLKTPSADMDQNIQFTEIDFMI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaccatttaaacacaaccggtttcgacctctggcacaccatccgcgaagaa
accgcggccgcggtctccgccgaaccgatgctggcaagttttttgcaccaaaccgtgttg
cgccacgagtccctcggctccgtccttgcctaccacctttccagcaaactcggcagcccg
attatggacgtgcgcgcgctgtttgaaatctaccagcaggcgttgggcagcgacacccaa
atcggcaaatgcgtcgaagcagacttaaaagccatctacgaacgcgatcccgcctgcgac
gaatattcgctgccgcttttatatttcaaaggcttccacgcgattcaggcacaccgcatc
aaccatcggctgtatctcgacgggcgcaaaacgctggcgtatttcctgcaaaaccgtatg
tccgaagtattcggcgtggacatccatcccgccgcccgtttcggatacgggctgatgctc
gaccacgccaccggctttgttgccggcgaaaccgccgtgttgggcaacaatatttcgatt
ttgcacggcgtaacgctcggcggttcgggcaaagaaggcggcgaccgccaccctaaaatc
ggcgacggcgtgatgatcggcgcaaacgcctcgatattgggcaatatccgcatcggcagc
aatgccaaaatcggggcgggcagcgtcgtggtttcagacgtgccgccgtccatcacggtt
gtcggcgtacccgccaaacccgtggcgcgatcgctcaaaacaccgtcggcggatatggat
caaaatatccagtttaccgaaatcgactttatgatttga

DBGET integrated database retrieval system