KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0564Help
Entry
NMB0564           CDS       T00027                                 

Gene name
nqrF
Definition
(RefSeq) Na(+)-translocating NADH-quinone reductase subunit F
  KO
K00351  Na+-transporting NADH:ubiquinone oxidoreductase subunit F [EC:7.2.1.1]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NMB0564 (nqrF)
Enzymes [BR:nme01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.1  Linked to oxidoreductase reactions
    7.2.1.1  NADH:ubiquinone reductase (Na+-transporting)
     NMB0564 (nqrF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NAD_binding_1 Fer2 FAD_binding_6 NAD_binding_6 FAD_binding_9 Fer2_4
Motif
Other DBs
NCBI-GeneID: 902679
NCBI-ProteinID: NP_273608
UniProt: Q9K0M8
Position
complement(592145..593362)
Genome map
AA seq 405 aa AA seqDB search
MEIILGIVMFTVIVLVLALMILFAKSKLVSEGDITIKVNGEKELTMPAGGKLLGALANEG
IFIPSACGGGGSCGQCRVVVKSGGGDILPTELSHISKREAREGCRLSCQVNVKTDMDIEV
PEEVFGVKKWECTVISNDNKATFIKELKLAIPEGEEVPFRAGGYIQIEAPPHTVAYKDFD
IPKEYHEDWDKYNLWQYVSKVDEPILRAYSMASYPEEKGIIMLNVRIATPPPRVPDAPPG
QMSSYIWSLKPGDKVTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLNSKR
KITFWYGARSKREMFYVEDFDQLAAEFPNFTWHVALSDPLPEDNWDGYTGFIHNVVYENH
LKNHEAPEDCEFYMCGPPIMNQSVIKMLKDLGVEDENILLDDFGG
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggagattattttaggtatcgtgatgtttaccgtcatcgttttggttttggcactgatg
attctgtttgccaaatccaaactggtcagcgaaggcgacatcaccatcaaagtcaacggc
gaaaaagagctgacgatgcccgccggcggcaaactcttgggcgcgcttgccaacgaaggc
atctttatcccctccgcctgcggcgggggcggttcgtgcggacaatgccgcgtcgtcgta
aaaagcggcggcggcgacatcctgccgaccgagctgtcccacatcagcaaacgcgaagca
cgcgaaggctgccgtctgtcgtgccaagtcaacgtcaaaaccgacatggacatcgaagtc
cccgaagaagtgttcggcgtgaaaaaatgggaatgcaccgtcatctccaacgataacaaa
gccacgttcattaaagaactcaagcttgccattcccgaaggcgaagaagtccccttccgc
gccggcggctacattcaaattgaagctcctcctcacactgttgcctacaaagacttcgac
attcctaaggaatatcacgaagactgggacaaatacaatttgtggcaatacgtttccaaa
gtggacgagccgattttgcgtgcctactctatggcttcgtatcctgaagaaaaaggcatc
attatgctgaacgtgcgtatcgccacgccgcccccgcgcgtacctgatgcgcctccggga
caaatgtcgtcctacatctggtcgctcaaacccggcgacaaagttacgatttccggcccg
ttcggcgaatttttcgccaaagacaccgatgccgaaatggtatttatcggcggcggtgcg
ggtatggctccgatgcgttcccacattttcgaccagttgaaacgtttgaactccaaacgt
aagattaccttctggtacggcgcacgttccaaacgcgagatgttctatgtcgaagacttt
gaccaactcgcggcagagttcccgaacttcacgtggcacgtcgccctgtccgacccgctg
ccggaagacaactgggacggctacacgggcttcattcacaacgtggtttacgaaaaccac
ctgaaaaaccacgaagcaccggaagactgcgaattttatatgtgcggccctccgattatg
aaccagtccgtcatcaaaatgctcaaagacttgggcgtggaagacgaaaacatcctcttg
gacgatttcggcggttaa

DBGET integrated database retrieval system