KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0574Help
Entry
NMB0574           CDS       T00027                                 

Gene name
gcvT
Definition
(RefSeq) glycine cleavage system aminomethyltransferase T
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00260  Glycine, serine and threonine metabolism
nme00630  Glyoxylate and dicarboxylate metabolism
nme00670  One carbon pool by folate
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    NMB0574 (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMB0574 (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    NMB0574 (gcvT)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     NMB0574 (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C POPLD SoxG
Motif
Other DBs
NCBI-GeneID: 902689
NCBI-ProteinID: NP_273618
UniProt: Q9K0L8
Position
602079..603179
Genome map
AA seq 366 aa AA seqDB search
MTALKTTPFHQAHQDAGAKLVDFAGWELPIHYGSQIAEHEAVRTDAGMFDVSHMLVTDVA
GANAKAFFRKLIANDVAKLAFVGKALYSALLNDNGGVIDDLIVYRTNEAETQYRIVSNGA
TREKDTAQFHKVGQEFGVAFNPRYDLGMLAVQGPKAIEKLLTVKPEWADVVHNLKPFQGA
DLGNDWFVARTGYTGEDGVEVILPGTEAVAFFKALQQAGVQPCGLGARDTLRMEAGMNLY
GNDMDDDTSPLEAGMGWTVDLKDESRDFVGKAALLALKEKGVAVKQVGLLLEKGGILRAH
MEVLTDKGQGETTSGVFSPSLKQSIAIARVPKDFDGDTAKVLMRGKEVDVRVLKLPFVRN
GQKQFD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgctctgaaaaccaccccatttcatcaagcccatcaagatgcaggcgcgaagctg
gtcgattttgccggctgggagctgcccatccattatggttcacaaatcgccgaacacgaa
gccgtgcgcaccgacgccggtatgtttgacgtatcccatatgctcgttaccgacgtagca
ggcgcaaatgccaaagcctttttccgcaaattgattgccaacgatgtcgccaagctcgct
tttgtcggcaaagccctttattccgctttgctcaacgacaacggcggtgtgattgacgac
ttaatcgtttaccgcaccaatgaagccgaaacccaataccgcatcgtgtccaacggcgcg
acccgcgaaaaagacacggcgcaattccacaaagtcggacaagagttcggcgtcgccttc
aatccgcgctacgacctcggcatgctcgccgtacaaggccctaaagccattgaaaaactc
ctgaccgtcaaacccgaatgggcagatgtcgtccataacctcaaaccgttccaaggcgcg
gatttgggcaacgactggtttgtcgcccgcaccggctacaccggcgaagacggcgtcgaa
gtcatcctgcccggcaccgaagccgtcgcattcttcaaagccctgcaacaagccggcgta
cagccctgcggcctcggcgcgcgcgacaccctgcgcatggaagccggcatgaacctctac
ggcaacgatatggacgacgacaccagcccgctcgaagcaggtatgggttggaccgttgac
ttgaaagacgaaagccgcgacttcgtcggcaaagccgccttgctggcattgaaagaaaaa
ggcgttgccgtcaaacaggtcggcctgttgctcgaaaaaggcggcatcctgcgcgcgcat
atggaagtgttgaccgacaaaggccaaggcgaaaccaccagcggcgtattctccccaagc
ctgaaacaatccatcgccatcgcgcgcgtaccgaaagattttgacggcgataccgccaaa
gtgctgatgcgtggcaaagaagtggacgtgcgtgtactgaagctgccgtttgtccgcaac
ggacagaaacagtttgattga

DBGET integrated database retrieval system