KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0578Help
Entry
NMB0578           CDS       T00027                                 

Gene name
nosD
Definition
(RefSeq) copper ABC transporter substrate-binding protein
  KO
K07218  nitrous oxidase accessory protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    NMB0578 (nosD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NosD Beta_helix
Motif
Other DBs
NCBI-GeneID: 902693
NCBI-ProteinID: NP_273622
UniProt: Q9K0L5
Position
606028..607062
Genome map
AA seq 344 aa AA seqDB search
MSLPAMDAGIYLEETAPRALIEHNNILDNSVGVYLHGSADAMVRENKIVGDATLRVNERG
NGVTVWNAPGAQVVGNDISKGRDGIFSNTSTHNTYKNNRFSDLRFAVHYMYTNDSEISGN
ISVGNNMGYVLMFSERLKVFDNIAVGSRDQGIMLNYVNYSDIHDNIINKAGKCVFAYNAN
YDKLFANHFENCQIGIHFTAAIEGTSLHDNSFINNESQVKYVSTRFLDWSEGGHGNYWSD
NSAFDLNGDGFGDSAYRPNGIIDQIIWRAPVSRLLMNSPAISIVKWAQAQFPAVLPGGVV
DSKPLMKPYAPKIQTRYQAMKDELLKEVETRQSEWGRAENGSLN
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcccgcaatggatgccggtatttatctcgaagaaactgccccgcgcgccctg
attgaacacaacaatattttggataattcggtcggcgtatatctgcatggttctgccgat
gcgatggtgcgcgagaataaaatcgtcggcgacgcgactttgcgcgtgaacgagcgcggc
aacggcgttaccgtttggaacgcacccggtgcgcaggtcgtcggcaacgacatttccaaa
gggcgggacggcattttttccaataccagcacgcacaacacctacaaaaacaaccgcttc
agcgatttgcgtttcgccgtccactatatgtacaccaacgacagcgaaatcagcggcaat
atttccgtgggcaacaatatgggctatgtgctgatgttttccgagcggctcaaagtattc
gacaatatcgccgtcggcagccgcgatcagggcattatgctcaactatgtcaactattcc
gatattcacgacaacattatcaacaaggcaggcaagtgcgtatttgcctataatgccaac
tacgataaacttttcgccaatcattttgaaaactgtcaaatcggcatacactttaccgcc
gccatcgaaggcacgtccttgcatgacaattcctttatcaacaacgaaagccaggtcaaa
tacgtcagcacgcgctttctcgattggagcgagggcggacacggcaactattggagcgac
aacagcgcgttcgatttgaacggcgacggcttcggagacagcgcgtaccgccccaacggc
atcatcgaccaaatcatctggcgcgcgcccgtatcgcgccttttgatgaacagtcccgca
atcagcatcgtcaaatgggcgcaggcgcagtttcccgccgttctgcctggcggcgtggtg
gacagcaaaccgctgatgaagccttatgcccccaaaattcaaacccgttatcaggcgatg
aaggacgagctactcaaagaagtcgaaacgcggcagtcggaatggggcagggcggaaaac
ggttctttgaactag

DBGET integrated database retrieval system