KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0587Help
Entry
NMB0587           CDS       T00027                                 

Definition
(RefSeq) membrane protein
  KO
K02075  zinc/manganese transport system permease protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Module
nme_M00244  Putative zinc/manganese transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0587
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Putative zinc/manganese transporter [MD:M00244]
    NMB0587
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC-3 FecCD
Motif
Other DBs
NCBI-GeneID: 902702
NCBI-ProteinID: NP_273631
UniProt: Q9K0K7
Position
complement(619290..620165)
Genome map
AA seq 291 aa AA seqDB search
MNLYDLLLAPFAEFDFMRYALASVFCLSLSAAPVGVFLVMRRMSLIGDALSHAVLPGAAV
GYMFAGLSLPAMGLGGVAAGMLMALLAGLVSRFTTLKEDANFAAFYLSSLAIGVVLVSKN
GSSVDLLHLLFGSVLAVDIPALQLIAAVSSLTLITLAVIYRPLVLESIDPLFLKSVGGKG
GLWHVLFLVLVVMNLVSGFQALGTLMSVGLMMLPAITARLWAKHMGALILLSVLTALLCG
LSGLLISYHIEIPSGPAIILCCSVLYLFSVILGKEGGILTKWLKNHRHHTT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaatctctacgacctgctccttgccccctttgcagaattcgactttatgcgctacgcc
ctcgcatccgtcttctgcctgtccctcagtgccgcacccgtcggcgtattcctcgtcatg
cgccgtatgagcctgataggcgacgcattgagccacgccgtcctgcccggtgccgccgtc
ggctacatgtttgccggcttgagcctgcccgccatgggtttgggcggcgtagccgcaggc
atgctgatggcactgcttgccggactcgtcagccgcttcaccaccctgaaagaagatgcc
aactttgccgccttttatctcagcagcctcgccatcggcgtagtcctcgtcagcaaaaac
gggagcagcgtcgatttgctccacctccttttcggctctgtacttgccgtcgatattcct
gccctgcagctcatcgccgccgtctccagcctcacgctcattacccttgccgtcatctac
cgcccgctcgtactcgaaagcatcgaccccctgtttctcaaatccgtcggcggcaaaggc
gggctttggcacgtcctctttctcgtcctggtcgtcatgaacctcgtatccggctttcaa
gccctcggcacactcatgtccgtcggactcatgatgctgccagccattaccgcccgcctg
tgggcgaagcatatgggcgcactcatcctcctatccgttctgacagccctgctgtgcggc
ttgagcggactgctcatttcctaccacatcgaaattccttccggtcccgccatcatcctc
tgttgcagcgtcctttatctcttttccgtcatactcggcaaagaaggcggcattctgacc
aaatggctcaaaaaccaccgccaccacaccacctga

DBGET integrated database retrieval system