KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0589Help
Entry
NMB0589           CDS       T00027                                 

Gene name
rplS
Definition
(RefSeq) 50S ribosomal protein L19
  KO
K02884  large subunit ribosomal protein L19
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme03010  Ribosome
Module
nme_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMB0589 (rplS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nme03011]
    NMB0589 (rplS)
Ribosome [BR:nme03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    NMB0589 (rplS)
  Bacteria
    NMB0589 (rplS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L19 MucB_RseB
Motif
Other DBs
NCBI-GeneID: 902704
NCBI-ProteinID: NP_273633
UniProt: Q9K0K5
Position
complement(621235..621600)
Genome map
AA seq 121 aa AA seqDB search
MNLIQQLEQEEIARLNKEIPEFAPGDTVVVSVRVVEGTRSRLQAYEGVVIARRNRGLNSN
FIVRKISSGEGVERTFQLYSPTVEKIEVKRRGDVRRAKLYYLRGLTGKAARIKEKLPARK
G
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgattcaacagctcgagcaagaagaaattgcccgcctgaataaagaaatcccc
gaattcgcaccgggcgacaccgtagtcgtatccgtacgcgtcgtggaaggtacccgcagc
cgtctgcaagcctacgaaggcgtggttattgcccgtcgcaaccgtggtctgaacagcaac
ttcatcgtccgcaaaatctccagcggcgaaggtgttgaacgtactttccaactgtactct
ccgaccgtcgaaaaaatcgaagtcaaacgccgtggcgacgtacgccgtgccaaactgtac
tacctgcgcggcctgaccggtaaagctgcacgcatcaaagaaaaactgcctgcacgcaaa
ggttga

DBGET integrated database retrieval system