KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0590Help
Entry
NMB0590           CDS       T00027                                 

Gene name
trmD
Definition
(RefSeq) tRNA (guanine-N(1)-)-methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Brite
KEGG Orthology (KO) [BR:nme00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:nme03016]
    NMB0590 (trmD)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     NMB0590 (trmD)
Transfer RNA biogenesis [BR:nme03016]
 Prokaryotic Type
  tRNA modification factors
   Methyltransferases
    NMB0590 (trmD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_m1G_MT
Motif
Other DBs
NCBI-GeneID: 902705
NCBI-ProteinID: NP_273634
UniProt: Q9K0K4
Position
complement(621616..622365)
Genome map
AA seq 249 aa AA seqDB search
MLIQAVTIFPEMFDSITRYGVTGRANRQGIWQFEAVNPRKFADNRLGYIDDRPFGGGPGM
IMMAPPLHAAIEHAKTQSSQAAKVIYLSPQGKPLTHQKAVELAELPHLILLCGRYEGIDE
RLLQSSVDEEISIGDFVVSGGELPAMMLMDAVLRLVPGVLGDMQSAEQDSFSSGILDCPH
YTKPLEFQGMAVPEVLRSGNHGLIAEWRLEQSLRRTLERRPDLLEKRVLIPKESRLLETI
RQEQREIQS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcttatccaggcagttaccattttccccgaaatgttcgacagcattacccgctacggc
gtaacgggacgcgcgaacagacagggaatctggcagtttgaagcagtcaatccccgaaag
tttgccgacaacagattgggctacatcgacgaccgcccgttcggcggcggcccgggaatg
attatgatggctccgccgcttcatgcggcaatagaacacgccaaaacacaatcctcccaa
gctgcaaaagtcatctacctcagcccccaagggaaaccgctgacacaccaaaaagcggta
gaactggcagaacttccgcatctgattctgctgtgcggacggtatgagggcatagacgaa
aggcttctgcaaagcagcgtcgatgaagaaatcagcatcggagacttcgttgtttccggc
ggagagcttcccgccatgatgctgatggatgcggtattgaggctcgtacccggcgtattg
ggcgatatgcagtctgccgaacaggattcgttctcaagcggcattttggactgcccccac
tacaccaaacccttagaatttcaaggtatggctgttccggaagtattgcgttccggcaat
catggcttgatagcggaatggcggttggaacaatcgctgcgccgcaccttggagcgcaga
cccgatcttttggaaaagcgcgttttaatcccaaaggaatcccgcctcttagaaaccatc
cggcaagagcaacgggaaatccaatcataa

DBGET integrated database retrieval system