KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0592Help
Entry
NMB0592           CDS       T00027                                 

Gene name
rpsP
Definition
(RefSeq) 30S ribosomal protein S16
  KO
K02959  small subunit ribosomal protein S16
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme03010  Ribosome
Module
nme_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:nme00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    NMB0592 (rpsP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nme03011]
    NMB0592 (rpsP)
   03029 Mitochondrial biogenesis [BR:nme03029]
    NMB0592 (rpsP)
Ribosome [BR:nme03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    NMB0592 (rpsP)
  Bacteria
    NMB0592 (rpsP)
Mitochondrial biogenesis [BR:nme03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    NMB0592 (rpsP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S16
Motif
Other DBs
NCBI-GeneID: 902707
NCBI-ProteinID: NP_273636
UniProt: P66438
Position
complement(622890..623135)
Genome map
AA seq 81 aa AA seqDB search
MVVIRLARGGSKHRPFYNVIVTDSRSRRDGRFIERVGFYNPVANEKQERVRLNADRLNHW
IAQGAQVSDSVAKLIKEQKAA
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
atggtagttatccgtttggcacgcggcggctcgaaacaccgccccttctacaacgtcatc
gttactgactcacgcagccgccgcgacggccgcttcatcgaacgcgtaggcttctacaac
cccgtagccaacgaaaaacaagagcgcgtccgcctcaatgcagaccgcctgaaccactgg
attgcacaaggcgcgcaagtcagcgactccgttgcaaaactgattaaagaacaaaaagcc
gcctaa

DBGET integrated database retrieval system