KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0603Help
Entry
NMB0603           CDS       T00027                                 

Gene name
hisE
Definition
(RefSeq) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00340  Histidine metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    NMB0603 (hisE)
Enzymes [BR:nme01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     NMB0603 (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG GIT_SHD
Motif
Other DBs
NCBI-GeneID: 902717
NCBI-ProteinID: NP_273647
UniProt: Q9K0J4
Position
complement(632957..633280)
Genome map
AA seq 107 aa AA seqDB search
MGDSVLSAIQQTITQRKSANPSESYVAQLLHKGEDKILKKVIEEAGEVLMASKDKNPSHL
VYEVADLWFHTMILLTHHDLKAEDVLDELARRQGLSGLVEKAARTES
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgggagattccgtactatccgccatccaacaaaccatcacccagcgaaaatctgccaat
ccgtccgaatcttacgtcgcacagctcttgcataagggcgaagacaaaatcctaaaaaaa
gtgattgaagaggcgggcgaagtgttgatggcatccaaagacaaaaacccgtcccacctg
gtttacgaagttgccgacttatggtttcacaccatgattcttctgacacaccacgacctg
aaggcggaagacgtattggacgaacttgcgcgccgtcaggggctgtcggggctggtcgaa
aaagccgctcgcacagaatcttga

DBGET integrated database retrieval system