KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0604Help
Entry
NMB0604           CDS       T00027                                 

Definition
(RefSeq) alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    NMB0604
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     NMB0604
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     NMB0604
    1.1.1.-  
     NMB0604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 FAD_binding_3 TrkA_N Pyr_redox_2 2-Hacid_dh_C NAD_binding_2 3HCDH_N Semialdhyde_dh HI0933_like
Motif
Other DBs
NCBI-GeneID: 902718
NCBI-ProteinID: NP_273648
UniProt: Q9K0J3
Position
complement(633421..634485)
Genome map
AA seq 354 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPTVAPGTVGINVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIKVGQHVVVEPYIIRDDVPTGEGSNYHLSKDMNF
IGLGGCGGGLSEKIAVKRRWVHPISDKIPLDQAALIEPLSVGHHAYVRSGAKEGDVALVG
GAGPIGLLLAAVLKAKGIKVIITELSKARKDKARESGVADYILDPSEVDVVAEVKKLTNG
EGVDVAFECTSVNKVLDTLVEACKPAANLVIVSIWSHPATINVHSVVMKELDVRGTIAYC
NDHAETIKLVEEGKINLEPFITQRIKLDELVSKGFERLIHNNESAVKIIVSPNL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagcacgtttttacgacaaaggcgacatccgcatcgaagacatccccgaaccg
accgtcgcccccggcactgtcggcatcaatgtcgcctggtgcggcatctgcggtactgac
ctgcacgaattcatggaaggcccgattttcattccgccttgcggtcatccgcacccgatt
tccggcgagtccgcacccgtaacgatgggacacgagttctccggcgtggtctatgccgtc
ggcgaaggcgtggacgacatcaaagtcggccaacacgtcgtggtcgaaccctacatcatc
cgcgatgacgtaccgaccggagaaggcagcaactaccacctctccaaagatatgaacttt
atcggcttgggcggctgcggcggcggtctgtccgaaaaaatcgccgtcaaacgccgttgg
gtgcatccgatttccgacaaaatcccgttggatcaagccgctttgatcgaaccgctgtct
gtcggacaccacgcctatgtacgcagcggcgcgaaagaaggcgacgtcgcattggtcggc
ggtgcaggtccgatcggtttgctgttggctgccgtgttgaaagccaaaggcatcaaagtc
atcatcaccgagttgagtaaagcacgcaaagacaaagcgcgcgaatccggcgttgccgac
tacatcctcgacccgtccgaagtcgatgttgttgcagaagtgaaaaaactgaccaacggc
gaaggcgtggacgtggcatttgagtgcaccagcgtcaacaaagtgttggatactttggtc
gaagcctgcaaacctgccgccaatttggttatcgtatccatctggagccaccccgccacc
atcaacgtccacagcgtcgtgatgaaagagttggacgtgcgcggcacgattgcctactgc
aacgaccacgccgaaaccatcaaactggtcgaagaaggcaaaatcaaccttgagcctttc
atcacccagcgcatcaagctggacgagctggtttccaaaggcttcgagcgtctgattcac
aacaacgaatccgccgttaaaattattgtgagtccaaacctgtaa

DBGET integrated database retrieval system