KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0612Help
Entry
NMB0612           CDS       T00027                                 

Gene name
potC
Definition
(RefSeq) spermidine/putrescine ABC transporter permease
  KO
K11074  putrescine transport system permease protein
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme02010  ABC transporters
Module
nme_M00300  Putrescine transport system
Brite
KEGG Orthology (KO) [BR:nme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    NMB0612 (potC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nme02000]
    NMB0612 (potC)
Transporters [BR:nme02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Putrescine transporter [MD:M00300] [OT]
    NMB0612 (potC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1 VirB3
Motif
Other DBs
NCBI-GeneID: 902726
NCBI-ProteinID: NP_273656
UniProt: Q9K0I7
Position
642519..643406
Genome map
AA seq 295 aa AA seqDB search
MQKSKLSWFLKLMLALSLAFLYIPLVVLVIYSFNESKLVTVWGGFSTKWYGALLENDTIL
EAAWLSLRIAVVSSLAAVVLGTLAGYAMARIKRFRGSTLFAGMISAPMVMPDVITGLSML
LLIIQVQIFLQGSEWLQHLYFDRGFFTIFLGHTTLCMAYITVVIRSRLVELDQSLEEAAM
DLGARPLKIFFVITLPLIAPAIASGFLLGITLSLDDLVITSFLSGPGSSTLPQVIFSKIK
LGLDPQMNVLATILIGIIGTLVIIVNYWMMRQATKRDREAAEAYRQEKLAAEKAN
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatccaaattatcttggttcttgaaactgatgttggcactgtcgctggcgttt
ctgtatatcccgctggttgttttggtcatctattcgtttaacgaatccaagctggtaacc
gtttggggcggcttttcgaccaagtggtacggcgcattgctggaaaacgacaccatcttg
gaagccgcttggctgtcgctgcggattgccgttgtgtcttcgcttgccgccgtcgttttg
ggcacgctggcaggctatgcgatggcgcggattaaacgttttcgcggcagtaccttgttc
gctggcatgatttccgcacctatggtgatgcccgacgtgattaccggtctgtctatgctg
ctgctgattattcaggtacagatatttttgcagggcagcgaatggttacaacatctctac
ttcgatcgtggctttttcaccatcttcctcggacatacgacgctgtgtatggcgtacatt
accgttgttatccgttcgcgtctggttgagcttgaccagtcgctcgaagaagccgcaatg
gatttgggcgcgcgcccgctgaaaatcttttttgtcatcactttgcctttgattgcccct
gccatcgcttcaggctttctgctcggcattaccctgtctttggatgatttggtgattacc
tcattcctctccggccccggttcatccacattgccgcaggtgattttctccaaaatcaag
ttgggtctcgatcctcagatgaatgtcttggcgaccatcctaatcggcatcatcggaaca
ttggtcatcatcgtcaattattggatgatgaggcaggcaaccaagcgtgaccgagaagcg
gcagaagcctaccgccaggaaaaattggctgccgagaaagcaaattaa

DBGET integrated database retrieval system