KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0618Help
Entry
NMB0618           CDS       T00027                                 

Gene name
ppsA
Definition
(RefSeq) phosphoenolpyruvate synthase
  KO
K01007  pyruvate, water dikinase [EC:2.7.9.2]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00620  Pyruvate metabolism
nme00680  Methane metabolism
nme01100  Metabolic pathways
nme01120  Microbial metabolism in diverse environments
nme01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0618 (ppsA)
  09102 Energy metabolism
   00680 Methane metabolism
    NMB0618 (ppsA)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.2  pyruvate, water dikinase
     NMB0618 (ppsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PPDK_N PEP-utilizers_C PEP-utilizers
Motif
Other DBs
NCBI-GeneID: 902731
NCBI-ProteinID: NP_273662
UniProt: Q9K0I2
Structure
PDB: 

Position
complement(649093..651477)
Genome map
AA seq 794 aa AA seqDB search
MADNYVIWFENLRMTDVERVGGKNASLGEMISQLTEKGVRVPGGFATTAEAYRAFLAHNG
LSERISAALAKLDVEDVAELARVGKEIRQWILDTPFPEQLDAEIEAAWNKMVADAGGADI
SVAVRSSATAEDLPDASFAGQQETFLNINGLDNVKEAMHHVFASLYNDRAISYRVHKGFE
HDIVALSAGVQRMVRSDSGASGVMFTLDTESGYDQVVFVTSSYGLGENVVQGAVNPDEFY
VFKPTLKAGKPAILRKTMGSKHIKMIFTDKAEAGKSVTNVDVPEEDRNRFSITDEEITEL
AHYALTIEKHYGRPMDIEWGRDGLDGKLYILQARPETVKSQEEGNRNLRRFAINGDKTVL
CEGRAIGQKVGQGKVRLIKDASEMDSVEAGDVLVTDMTDPDWEPVMKRASAIVTNRGGRT
CHAAIIARELGIPAVVGCGNATELLKNGQEVTVSCAEGDTGFIYAGLLDVQITDVALDNM
PKAPVKVMMNVGNPELAFSFANLPSEGIGLARMEFIINRQIGIHPKALLEFDKQDDELKA
EITRRIAGYASPVDFYVDKIAEGVATLAASVYPRKTIVRMSDFKSNEYANLVGGNVYEPH
EENPMLGFRGAARYVADNFKDCFALECKALKRVRDEMGLTNVEIMIPFVRTLGEAEAVVK
ALKENGLERGKNGLRLIMMCELPSNAVLAEQFLQYFDGFSIGSNDMTQLTLGLDRDSGLV
SESFDERNPAVKVMLHLAISACRKQNKYVGICGQGPSDHPDFAKWLVEEGIESVSLNPDT
VIETWLYLANELNK
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atggccgacaactacgtaatctggtttgaaaacctgcgtatgacagatgttgaacgcgtg
ggcggtaaaaacgcctcgctgggcgaaatgatcagtcagctgaccgaaaaaggcgttcgc
gtccccggcggctttgccaccacggccgaagcctaccgcgcattcctcgcacacaacggt
ctgagcgaacgcatttccgccgcactggcaaaattggatgtcgaagacgttgccgaactg
gcacgcgtcggcaaagaaatccgccaatggattttggatacgcctttccccgaacagctc
gatgccgaaatcgaagcggcatggaacaaaatggttgccgatgccggcggtgcggacatt
tccgttgccgtacgttcttccgcaactgccgaagacctgccggacgcatcattcgctgga
caacaggaaaccttcttgaacatcaacggcttggataacgttaaagaagcgatgcaccat
gtattcgcttccctgtataacgaccgtgccatttcttaccgtgtccacaaaggcttcgaa
cacgacatcgtcgccctttccgccggcgttcaacgcatggtgcgttccgacagcggcgca
tcaggtgtgatgttcaccctcgacaccgaatccggctacgatcaagtcgtctttgttacc
tcctcttacggtctgggcgaaaacgtcgtacaaggtgcggtcaacccggacgaattttat
gtgttcaaacccacgctcaaagcgggcaagcccgccatcctgcgtaaaaccatgggttca
aaacacatcaaaatgatttttaccgacaaagcagaagccggtaaatccgtaaccaacgtc
gatgtccccgaggaagaccgcaaccgcttctccattaccgacgaagaaattactgagttg
gcgcattacgcactgaccatcgaaaaacactacggccgcccgatggatatcgaatgggga
cgcgacggcttggacggcaaactctacatcctgcaagcccgtcccgaaaccgtaaaatcc
caagaagagggcaaccgcaacctgcgccgcttcgccatcaacggcgacaaaaccgtatta
tgcgaaggccgcgccatcggtcagaaagtcggtcagggcaaggtgcgcctgattaaagat
gcttccgagatggattccgtcgaagccggcgacgtactcgttaccgacatgaccgatccg
gattgggaacccgtgatgaaacgtgcttctgccatcgttaccaaccgcggcggccgtacc
tgccacgccgccatcatcgcgcgtgaattgggcattcctgccgttgtcggctgcggcaat
gcaaccgaattgctgaaaaacggtcaagaagttaccgtatcctgtgccgaaggcgatacc
ggctttatctatgccggtctgttggacgtacagattaccgatgtcgccttagacaatatg
cctaaagcacctgtaaaagtcatgatgaacgtcggcaatcccgaactcgcattcagcttc
gccaacctgcccagcgaaggcatcggcttggcgcgtatggaatttatcatcaaccgccaa
atcggtatccaccccaaagccttgttggaatttgacaaacaagacgacgaattaaaagcg
gaaattacccgccgtatcgccggttacgcgtcccctgtcgacttctacgtcgataaaatc
gccgaaggcgtggcgacattggccgcatcggtttatccgcgtaaaaccatcgtccgtatg
tccgacttcaaatccaacgaatacgccaacctggtcggcggcaacgtatacgaaccgcat
gaagaaaacccgatgttgggcttccgtggtgcggcgcgttatgtcgccgacaacttcaaa
gactgtttcgccttggaatgcaaagccttgaaacgcgtccgcgatgaaatggggttgacc
aacgttgaaatcatgattccgttcgtccgcactttgggcgaagccgaagccgttgtcaaa
gccctgaaagaaaacggcttggaacgcggcaaaaacggcctgcgcctgattatgatgtgc
gagctgccgagcaacgcggtattggcggaacaattcctgcaatacttcgacggcttctcc
atcggctcgaacgacatgacccaactgaccctcggtctcgaccgcgacagcggcttggta
tccgaatcgtttgacgaacgcaaccctgccgtcaaagtgatgctgcaccttgccatctcc
gcctgccgcaagcagaacaaatatgtcggcatctgcggtcaaggcccgtccgaccatccg
gacttcgccaaatggctggttgaggaaggcattgaaagcgtttccctgaacccggatacc
gtcatcgaaacttggctatatttggcgaatgaattgaacaaataa

DBGET integrated database retrieval system