KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0638Help
Entry
NMB0638           CDS       T00027                                 

Gene name
galU
Definition
(RefSeq) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00040  Pentose and glucuronate interconversions
nme00052  Galactose metabolism
nme00500  Starch and sucrose metabolism
nme00520  Amino sugar and nucleotide sugar metabolism
nme01100  Metabolic pathways
nme01130  Biosynthesis of antibiotics
Module
nme_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NMB0638 (galU)
   00052 Galactose metabolism
    NMB0638 (galU)
   00500 Starch and sucrose metabolism
    NMB0638 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NMB0638 (galU)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NMB0638 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-GeneID: 902749
NCBI-ProteinID: NP_273681
UniProt: Q9K0G7
Position
complement(672283..673152)
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEASQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatacggaaagccgttttccccgtcgcagggatgggaacccgcttcctgccc
gccaccaaggccagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggagacgaaccctttgccgttatccttgccgacgacctgattgatgcccccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggcaacagcattttgggcgta
gaaaccgttgaagcatcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgttgttggacgctacatcctcaccccgcgcattttcgacctcttaaccaatctt
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctggcgcacccctttgaaggtacgcgctacgactgcggcagcaaactgggc
tacctcgaagccaccgtcgcctacggtctgaaacatcccgaaaccggcgaacccttccgc
cggcttttggaaaaataccgcaccgaataa

DBGET integrated database retrieval system