KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0661Help
Entry
NMB0661           CDS       T00027                                 

Definition
(RefSeq) bis(5'-nucleosyl)-tetraphosphatase
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrkH Form-deh_trans
Motif
Other DBs
NCBI-GeneID: 903194
NCBI-ProteinID: NP_273703
UniProt: Q4W573
Position
complement(687395..688852)
Genome map
AA seq 485 aa AA seqDB search
MHKILPIAHVLSRLGMLFSFILLIPAALSYAFSDGAYTAFATTATVTLSGSCIVRLATLR
FRRELRPRDGFTLVLMLWLAFAAMAAMPMYLYFPNMGFTDAFFESMSGLTTTGATVIPHV
DGLAPSVNFWRHMLNWLGGMGIIVLAVAILPMLGVGGTQLFKAEIPGIDKESKMSPRISQ
VAKKLWFGYTLITILAAACLHFAGMGWFDAVCHAMATLSLGGFSTHDASIAYYNSPLIEA
VIIVFTIVGGINFANHFAALNSRSLKTYWKDEECRTMLLLLSGSILAAALYLWHTGYYAG
FTESLRYTAFNFVSIGLANGLANTDFAQWPLLISLWMFFLANILANSGSTGGGIKTIRAL
VLFKFSLREMMVLLHPKAVRTVKISGKAIPDRLALTVMSFIFIYFMTVVLFSFLLMASGM
EFTTAFTAVIACITNAGPGLGEVGPAGNYAGLDVMQKWICVTAMLLGRLEIFTVFILFTP
AYWKK
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaatcctgcccatcgcccacgtcctctcccgactgggtatgctgttttccttt
atcctgctgatacccgccgccctctcctacgccttttcggacggcgcgtacaccgccttc
gccaccaccgcgaccgttaccctttccggctcgtgcatcgtccggctcgccaccctccgg
ttcaggcgcgaactgcgcccgcgcgacggctttaccctcgtcctgatgttgtggctggcg
tttgccgctatggctgcgatgccgatgtacctgtatttcccgaatatgggctttaccgac
gcattttttgaatcgatgtcgggactgaccaccaccggcgcgaccgtcatcccccacgtc
gacgggctcgccccctccgtcaacttttggcggcatatgctcaactggctgggcgggatg
ggcatcatcgtccttgccgtcgccatcctgcctatgctcggcgtaggcggcacgcagtta
ttcaaagccgaaatccccggcattgacaaagaaagcaaaatgtcgccgcgcatttcccaa
gtggcgaaaaaactttggttcggctacaccctgatcaccatcctcgcggcagcctgcctg
cattttgccgggatgggctggttcgatgccgtctgtcacgcgatggctaccctctcgctg
ggcgggttttccacccacgatgccagcatagcttattacaactcccccctcatcgaagcg
gtcatcatcgttttcaccattgtcggcggcatcaattttgccaaccatttcgccgccctc
aacagccgcagcctcaaaacctattggaaagacgaagaatgccggacgatgctgctgctg
ctctccggcagcatccttgccgccgccctgtacctgtggcacaccggctattacgccggt
tttaccgaatccctgcgctacaccgccttcaacttcgtctccatcggactggcaaacggg
ctggccaacaccgacttcgcacaatggccgctcctgatttccctgtggatgtttttcctc
gccaacatcctcgccaactccggctcgaccggcggcggcatcaaaaccatacgcgccctc
gtcctgttcaaattcagcctgcgcgaaatgatggtgctgctgcaccccaaagccgtccgc
accgtcaaaatcagcggcaaggccatacccgaccgcctcgcgctgaccgttatgtccttc
atcttcatctactttatgaccgtcgtcctcttcagcttcctgctgatggcgagcggtatg
gaatttaccaccgccttcaccgccgtcatcgcctgcatcaccaacgccggccccggcctg
ggcgaagtcgggcccgccggcaattacgccggtttggacgtgatgcagaaatggatctgc
gttaccgccatgctcttgggcaggctggaaatcttcaccgtcttcatcctcttcaccccc
gcctactggaagaaataa

DBGET integrated database retrieval system