KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0671Help
Entry
NMB0671           CDS       T00027                                 

Gene name
sfcA
Definition
(RefSeq) malate oxidoreductase
  KO
K00027  malate dehydrogenase (oxaloacetate-decarboxylating) [EC:1.1.1.38]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00620  Pyruvate metabolism
nme01200  Carbon metabolism
nme02020  Two-component system
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    NMB0671 (sfcA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    NMB0671 (sfcA)
Enzymes [BR:nme01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.38  malate dehydrogenase (oxaloacetate-decarboxylating)
     NMB0671 (sfcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: malic Malic_M ELFV_dehydrog IFT57 Malate_DH SWIRM-assoc_3
Motif
Other DBs
NCBI-GeneID: 902782
NCBI-ProteinID: NP_273713
UniProt: Q9K0D8
Position
699369..700649
Genome map
AA seq 426 aa AA seqDB search
MENSLKEAALKFHEFPVPGKISVTPTKSLATDKDLALAYSPGVAAPCMEIHADPQNAYKY
TAKGNLVAVISNGTAVLGLGDIGALAGKPVMEGKGVLFKKFAGVDVFDIEIDEKDPQKLV
DIIAALEPTFGGINLEDIKAPECFYIERELRKRCKIPVFHDDQHGTAIITAAAVLNALRF
TGRKIEEATLVCSGAGAAAIACLNQLLDLGLKRENVTVCDSKGVIYQTREDKDRMDESKQ
FYAIEDNGQRVLADAVKGKDIFLGLSGANLLTPEILNTMNEKPIVFAMANPNPEILPPLA
KETRPDVVIGTGRSDFPNQVNNVLCFPFIFRGALDVGATTINEEMKRACVYALADLAMEE
VTEEVVAAYGKKFEFGAEYLIPTPFDSRLLPRVATAAAKAAMESGVATRPIADLEAYAAK
LSEWKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactcattgaaagaagccgccctcaagttccacgaattccccgtgccgggcaaa
atttccgttaccccgaccaaatctctggcgaccgacaaagatttggcgttggcgtactct
ccgggcgtagccgctccttgtatggaaatccatgccgatccgcaaaatgcctacaaatac
accgccaaaggcaacttggtcgctgtcatttccaacggtacggccgttttgggcttgggc
gacatcggcgcgctggcgggcaaacccgtgatggaaggcaaaggcgtattgttcaaaaaa
ttcgccggtgtggacgtgttcgacatcgaaatcgatgaaaaagacccgcaaaaactcgtg
gacatcatcgccgctttagagccgaccttcggcggcatcaacctcgaagacatcaaagca
cccgagtgtttctacatcgaacgcgaattacgcaaacgctgcaaaatccccgtattccac
gacgaccagcacggcacggccatcattaccgccgccgccgtattgaacgccctgcgtttt
accggccgtaaaatcgaagaagcgactttggtgtgttccggcgcaggtgcggccgcgatt
gcctgcttgaaccaattgctggatttgggcttgaaacgcgaaaacgtgaccgtttgcgac
tccaaaggcgtgatttaccaaacccgcgaagacaaagaccgtatggacgagtccaaacag
ttctacgccattgaagacaacggccagcgcgtgcttgccgatgccgtcaaaggcaaagac
atcttcttgggcctctccggcgcgaacctgctgacgcctgaaatactgaacaccatgaac
gaaaaacccatcgtgttcgctatggccaacccgaatccggaaatcctgccgccgctggcg
aaagaaacccgtccggacgtggttatcggtaccggccgctccgacttcccgaaccaagtg
aacaatgtattgtgcttcccgttcatcttccgcggtgcgttggatgtcggcgcgacgacc
atcaacgaagaaatgaaacgcgcctgcgtgtatgctttggcggatttggcgatggaagaa
gtaaccgaagaagtggttgccgcttacggtaagaaatttgaattcggcgcggaatacctg
attccgactccgttcgattcccgcctgctgccgcgcgttgctacggctgccgccaaagca
gcgatggaaagcggtgtggcaacccgtccgattgcagatttggaagcttacgctgccaag
ctgagcgaatggaagctgtaa

DBGET integrated database retrieval system