KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0684Help
Entry
NMB0684           CDS       T00027                                 

Gene name
ribH
Definition
(RefSeq) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00740  Riboflavin metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    NMB0684 (ribH)
Enzymes [BR:nme01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     NMB0684 (ribH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMRL_synthase
Motif
Other DBs
NCBI-GeneID: 902796
NCBI-ProteinID: NP_273726
UniProt: P66037
Position
complement(710309..710785)
Genome map
AA seq 158 aa AA seqDB search
MNTIAPNLDGKHLRIGIVQARFTNEIGSEMLKVCCRTLQELGVADENITVATVPGALEIP
IALMNFASSEKFDALIAIGVVIRGETYHFELVSNESGAGVSRVALDYNIPIANAVLTTEN
DAQAIERIEEKASDAAKVAVECANLVNLLLEEQFEDEE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaacaccatcgcccccaacctcgacggcaaacacctccgcatcggcatcgtacaggca
cgcttcaccaacgaaatcggcagcgaaatgctcaaagtctgctgccgcaccctccaagaa
ttgggcgtggcagacgaaaacattaccgtcgccaccgtacccggcgcgcttgaaatcccc
atcgcgctgatgaactttgcctcttccgaaaagtttgacgcactgattgccatcggcgtc
gtcatccgtggcgaaacctaccatttcgagctggtttccaacgaatccggagcaggcgtc
agccgcgtcgcactcgactacaatatcccgattgccaatgccgtcctaaccaccgaaaac
gacgcgcaggcaatcgaacggattgaagaaaaagcctcggatgccgccaaagtcgccgtc
gaatgcgccaacctcgtcaacctgctgctcgaagaacagtttgaagacgaagaataa

DBGET integrated database retrieval system