KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0688Help
Entry
NMB0688           CDS       T00027                                 

Gene name
trpF
Definition
(RefSeq) N-(5'-phosphoribosyl)anthranilate isomerase
  KO
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
nme01230  Biosynthesis of amino acids
Module
nme_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMB0688 (trpF)
Enzymes [BR:nme01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     NMB0688 (trpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRAI
Motif
Other DBs
NCBI-GeneID: 902800
NCBI-ProteinID: NP_273730
UniProt: Q9K0C6
Position
complement(714856..715482)
Genome map
AA seq 208 aa AA seqDB search
MRKIRTKICGITTPEDAAAAAAAGADAVGLVFFQGSSRAVDIARAKKITAALPPFVSVVA
LFVNESAQNIRRILAEVPIHIIQFHGDEDDAFCRQFHRPYIKAIRVQTASDIRNAATRFP
DAQALLFDAYHPSEYGGTGNRFDWTLLAEYSGKPWVLAGGLTPENVGEAVRITGAESVDV
SGGVEASKGKKDAAKVAAFIATANRLSR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaggaaaatccgcaccaaaatctgcggcatcaccacaccggaagacgcagctgccgcc
gcagcggcaggtgcggatgccgtcgggctggtctttttccaaggcagcagccgggccgtc
gatattgcccgcgccaaaaaaatcaccgccgcactgccgccgtttgtcagcgttgtcgcc
cttttcgtcaacgaaagcgcgcaaaacatccgccgcatccttgccgaagtgccgatacac
atcatccaattccacggcgacgaagacgacgcattctgccgccagttccaccgcccctat
atcaaagccattcgtgttcagacggcatcagacatccgaaacgccgccacgcgcttcccc
gacgctcaggcactgctgttcgatgcctaccatccttcggaatacggcggcaccggaaac
cgcttcgactggacgctgctggcggaatattcgggcaaaccgtgggtgcttgccggcggg
ctgacccctgaaaacgtcggcgaagccgtccgcatcaccggagcggaatcggtcgatgta
tccggcggtgtggaagcgtctaaaggcaaaaaagatgccgccaaagtcgccgcctttatc
gcaaccgccaaccgcctatcccgttaa

DBGET integrated database retrieval system