KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0690Help
Entry
NMB0690           CDS       T00027                                 

Gene name
purF
Definition
(RefSeq) amidophosphoribosyltransferase
  KO
K00764  amidophosphoribosyltransferase [EC:2.4.2.14]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00230  Purine metabolism
nme00250  Alanine, aspartate and glutamate metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
nme01130  Biosynthesis of antibiotics
Module
nme_M00048  Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:nme00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMB0690 (purF)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NMB0690 (purF)
Enzymes [BR:nme01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.14  amidophosphoribosyltransferase
     NMB0690 (purF)
Peptidases [BR:nme01002]
 Cysteine Peptidases
  Family C44
   NMB0690 (purF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_6 GATase_7 Pribosyltran GATase_4 AP_endonuc_2
Motif
Other DBs
NCBI-GeneID: 902802
NCBI-ProteinID: NP_273732
UniProt: Q9K0C4
Position
complement(716132..717676)
Genome map
AA seq 514 aa AA seqDB search
MCGVLGLVSHEPVNQLLYDGLQMLQHRGQDAAGIATAEGGTFHMHKGKGMVREVFRTRNM
RDLTGNAGIAHVRYPTAGNAGSSAEAQPFYVSSPFGIVLAHNGNLTNTAELYENVCNKHL
RHVNTSSDSEVLLNVFAHELRREVSKNADPHRLNADNIFNAVAQVHRLVRGAYGVIAMIA
GYGMLAFRDPYGIRPLVLGSQTDSEGRKSYAVASESVAFNALTYDLERDIRPGEAVFVGF
DGTMIARQCSDRAKLSPCLFEYVYFARPDSVIDGVSVYQSRLDMGVSLAEKIKRELPVDG
IDVVMPIPDTSRPSAMELAVHLDKPYREGLIKNRYIGRTFIMPGQATRKKSVRQKLSPME
TEFAGKSVLLVDDSIVRGTTSREIVEMVRAAGARKVYIASAAPEVRYPNVYGIDMPTREE
LIANGRSAAEIAAEIGADGIVFQDLGDLEAVVKALNPKIESFDSSCFNGIYQTGDIDDAY
LDRLSAEKSGCGGLKIHPSRMEHSISISDAGDEE
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgtattaggtttggtcagtcatgaacccgtgaaccagcttctgtacgacggc
ttgcagatgttgcagcacagggggcaggatgcggcgggcattgcaacggcggaaggcggt
accttccatatgcacaaaggcaaaggcatggtgcgcgaagtgttccgcacacgcaatatg
cgcgatttgaccggcaacgccggcatcgcccacgtccgttatcctactgcgggcaacgca
ggcagcagcgcggaggcgcagcctttctacgtcagctcgccgttcggcatcgttttggcg
cacaacggcaacctcaccaacactgccgaactgtatgaaaacgtgtgtaacaaacacctg
cgccacgtcaacaccagctccgattccgaagtcttgctcaacgtattcgcgcacgaatta
cgccgcgaagtctctaaaaacgccgacccgcaccggctcaatgccgacaatattttcaac
gccgttgcccaagtccaccgcctggtgcgcggcgcatacggtgtgattgccatgattgcg
ggctacggtatgctcgccttccgcgacccttacggcatccgcccgctggtattgggttcg
caaaccgacagcgaaggcagaaaatcctatgccgtcgcctccgaatccgtcgccttcaac
gcgcttacctacgatttggaacgcgacatccggccgggcgaagcggtatttgtcggcttt
gacggcacaatgattgcccgccaatgcagcgaccgtgccaaactcagcccctgccttttt
gaatatgtttattttgcccgccccgactctgtgattgacggcgtatccgtttaccaatcg
cgcttggatatgggcgtgtcgctggcggaaaaaatcaaacgcgagctgcccgtggacggc
atcgatgtcgtgatgcccattcccgacaccagccgccccagcgcgatggagcttgccgtc
catctcgacaaaccctaccgcgagggtttgattaaaaaccgctatatcggccgcaccttt
attatgcccggacaggcgacgcgcaaaaaatccgtgcgccaaaaactcagcccgatggaa
accgaatttgcaggcaaaagcgtgttgctggtggacgactccatcgtgcgcgggacgacc
agccgcgaaatcgtcgaaatggtacgcgcggcgggcgcgcgcaaagtctatatcgcctcc
gccgcgcccgaagtgcgctatcccaatgtgtacggcattgatatgcccacgcgcgaagag
ttgattgccaacgggcgcagcgcggcggaaatcgccgccgaaatcggcgcggacggcatc
gtatttcaagacttgggcgatttggaagccgtcgtcaaagcactcaatccgaaaatcgaa
tccttcgattcgtcctgtttcaacggcatttatcagaccggcgacatcgatgatgcctac
ctcgaccgcctgtctgccgagaaatccggctgcggcggtctgaaaatccacccgagcagg
atggaacacagcatcagcatcagcgatgcgggcgacgaagaataa

DBGET integrated database retrieval system