KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0718Help
Entry
NMB0718           CDS       T00027                                 

Gene name
hemH
Definition
(RefSeq) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00860  Porphyrin and chlorophyll metabolism
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMB0718 (hemH)
Enzymes [BR:nme01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     NMB0718 (hemH)
    4.99.1.9  coproporphyrin ferrochelatase
     NMB0718 (hemH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase CbiX Binary_toxB
Motif
Other DBs
NCBI-GeneID: 902830
NCBI-ProteinID: NP_273760
UniProt: Q9K097
Position
complement(748528..749610)
Genome map
AA seq 360 aa AA seqDB search
MPSEAASDGILPLYPTRTIFQKPIMLPFFPEPSLSYTQQNRTAVLLLNLGTPDAPTAQAV
RPYLKSFLTDRRVVELPKWLWYPILHGLVLTLRPKKSAHAYEKIWFKEGSPLEVYTARQA
AALAKRMPDLIVRHAMTYGNPSVADVLSELKAQGAGRLLVIPMYPQYAASSSGAAVDKVC
EQLLLQRNQMSVRTVSRFYDDTGYIDAMKNHILRYWAEHGRGKKLMLSFHGVPQKHHDLG
DPYPDECRHTAKLLAEALELTEDQYVVSFQSQFGRAKWVTPSTQDLFGKLPKQGVTELDV
FCPGFLADCLETMEEIALMGREQFYEAGGKSYRYIPCLNDNPDWIDALVALAEENLGSWR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaagccgcttcagacggcattttgccgctttaccctacccgcactattttt
cagaaaccgatcatgcttccattctttccagaaccctccctttcctatacgcaacaaaac
cgtaccgccgttttgctgttgaacctcggcacgcccgacgcgccgaccgcgcaggcggta
cgaccttatctgaagtcctttctgaccgaccggcgcgtcgtcgaactgcccaaatggctg
tggtatcccattctgcatggtctggtactgacgctccgccccaaaaaaagcgcgcacgcc
tatgaaaaaatctggtttaaggaaggttcgcccttagaagtttacacagcacgccaagct
gccgcgcttgccaaacgtatgcccgacctcatcgtccgccacgccatgacctacggcaat
ccttcggtggcagacgtattgtcggaactgaaggcgcaaggcgcgggcagactgctggtc
atcccgatgtacccgcaatatgccgcttccagcagcggagcggcagtagataaggtgtgc
gaacaattactgctgcaacggaaccaaatgagcgtccgcaccgtttcgcgcttttatgac
gataccggctacattgatgcgatgaaaaaccacatcctccgatattgggcggaacacggg
cgcgggaaaaaactgatgttgagttttcacggcgtaccgcagaagcaccacgacctcggc
gacccctatcccgacgagtgccgccacaccgccaaactgcttgccgaagcactggaactg
accgaagaccaatatgtcgtatcgttccaaagccaattcggcagggcaaaatgggttaca
ccgagcacgcaggatttgttcggcaaactgcccaaacagggggtaaccgagctggacgta
ttttgcccgggctttttggcagactgtttggaaaccatggaagaaatcgccctgatgggg
cgggaacagttttatgaagcaggcggcaaaagctaccgctacatcccctgcctcaacgac
aaccccgactggatagatgcactcgtcgcacttgccgaagaaaaccttggcagctggcgt
tga

DBGET integrated database retrieval system