KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0734Help
Entry
NMB0734           CDS       T00027                                 

Definition
(RefSeq) hypothetical protein
  KO
K03181  chorismate--pyruvate lyase [EC:4.1.3.40]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00130  Ubiquinone and other terpenoid-quinone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB0734
Enzymes [BR:nme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.40  chorismate lyase
     NMB0734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chor_lyase Thrombin_light
Motif
Other DBs
NCBI-GeneID: 902847
NCBI-ProteinID: NP_273776
UniProt: Q9K084
Position
765557..766033
Genome map
AA seq 158 aa AA seqDB search
MEHLFGKWLPDLPAAISDGISLPMVRLLHTRSLTAALRALPHTFSVELLKLGELETECGG
RLVREVLLKLDRIPVVEARSECRIGSAFWQNILDCGTRPLGERLFQADLEGARSAFEFAV
AGEGCGRYFAARRSRFSRHGEEMLLTEYFLPELKRFIG
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggaacacctatttgggaaatggctgcccgacttgcccgccgccatttcagacggcatc
agcctgccgatggtgcggctgctgcacacccggtcgctgaccgccgcattgcgcgccttg
ccgcatacattttcggtggaactgctgaaactgggcgaattggagacggaatgcggaggg
aggctggtgcgcgaagttttgttgaagctggaccgtatccctgttgttgaggcaaggagc
gaatgccgtatcggttcggcgttttggcaaaacattttggactgcggcacgcgtcctttg
ggcgagcgtctgtttcaagccgatttggaaggggcgcgttcggcgtttgagtttgccgtt
gccggcgaaggatgcggacggtactttgccgcgcggcgttctcggttttcccgtcacggc
gaggaaatgctgctgaccgagtattttctgcccgaactgaaacgttttatcggataa

DBGET integrated database retrieval system