KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0743Help
Entry
NMB0743           CDS       T00027                                 

Gene name
ubiE
Definition
(RefSeq) ubiquinone/menaquinone biosynthesis methyltransferase
  KO
K03183  demethylmenaquinone methyltransferase / 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase [EC:2.1.1.163 2.1.1.201]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00130  Ubiquinone and other terpenoid-quinone biosynthesis
nme01100  Metabolic pathways
nme01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    NMB0743 (ubiE)
Enzymes [BR:nme01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.163  demethylmenaquinone methyltransferase
     NMB0743 (ubiE)
    2.1.1.201  2-methoxy-6-polyprenyl-1,4-benzoquinol methylase
     NMB0743 (ubiE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ubie_methyltran Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_23 Methyltransf_12 Methyltransf_29 Methyltransf_8 CMAS MTS PCMT RrnaAD MetW
Motif
Other DBs
NCBI-GeneID: 902858
NCBI-ProteinID: NP_273785
UniProt: Q9K075
Position
776135..776872
Genome map
AA seq 245 aa AA seqDB search
MGGQKTHFGFSTVNEDEKAGKVAEVFHSVAKNYDIMNDVMSAGLHRVWKHFTINTAHLKK
GDKVLDIAGGTGDLSRGWAKRVGKEGEVWLTDINSSMLTVGRDRLLNEGMILPVSLADAE
KLPFPDNYFNLVSVAFGLRNMTHKDAALKEMYRVLKPGGTLLVLEFSKIYKPLEGAYDFY
SFKLLPVMGRLIAKDAESYQYLAESIRMHPDQETLKQMMLDAGFDSVDYHNMSAGIVALH
KGVKF
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgggcggacagaaaacgcatttcggattcagtacggtcaacgaagatgaaaaagccggc
aaagtggcggaagtgttccactccgtcgccaaaaactacgacattatgaacgatgtgatg
tcggcagggctgcacagggtgtggaagcatttcaccatcaacacggcgcacctgaaaaaa
ggcgataaagtgttggacattgcgggcggtacgggcgatttgtcgcgcggttgggcgaaa
cgggtcggcaaggaaggcgaggtttggctgaccgatattaattcctctatgctgaccgtc
gggcgcgaccgtctgttgaacgaaggcatgattttgcccgtatcgcttgccgatgcggaa
aaactgcctttccccgacaattatttcaacttggtttccgtggcgttcggcttgcggaac
atgacgcataaagatgccgcgctgaaagagatgtaccgtgttttgaaaccgggcggcacg
ttgctggtgttggagttttccaaaatctacaaacctttggaaggcgcgtatgatttctat
tcgttcaagctgctgccggtcatgggcaggctgattgcgaaagatgcggagagttaccag
tatcttgccgaatccatccgtatgcaccccgatcaggaaactttgaaacagatgatgctg
gatgcgggcttcgacagcgtggattatcacaatatgagtgcgggcatcgtcgcgctgcat
aagggcgtgaaattttaa

DBGET integrated database retrieval system