KEGG   Neisseria meningitidis MC58 (serogroup B): NMB0745Help
Entry
NMB0745           CDS       T00027                                 

Gene name
folK
Definition
(RefSeq) 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
  KO
K00950  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nme  Neisseria meningitidis MC58 (serogroup B)
Pathway
nme00790  Folate biosynthesis
nme01100  Metabolic pathways
Module
nme_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:nme00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMB0745 (folK)
Enzymes [BR:nme01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NMB0745 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HPPK
Motif
Other DBs
NCBI-GeneID: 902860
NCBI-ProteinID: NP_273787
UniProt: Q9K073
Position
complement(777697..778191)
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDTRLTLPHPR
AHERSFVIRPLAEILPDFVLGKHGKVAELSKRLGNQGIRLLPDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcccgattttgtcaatgcc
gtctgcaccgtttccaccactctggacggcattgccctgcttgccgaactcaaccgtatc
gaggctgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacacccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatccgccctttggcagaaatcctccctgattttgtttta
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggtatccgtctt
ttaccggacaggtaa

DBGET integrated database retrieval system